Os10t0100500-01

Locus

Os10g0100500

Description

Serine/threonine protein kinase-related domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK285

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 285

Oryzabase Gene Symbol Synonym(s)

OsPUB61, OsRLCK285

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 61, U-box protein 61, Receptor-like Cytoplasmic Kinase 285

Transcript Evidence

AK102556 (DDBJ, Best hit)

Protein Evidence

B9G587 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: response to stress (GO:0006950)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

U box domain (IPR003613)

UspA (IPR006016)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033097G03 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0100500-01)

RiceXPro (AK102556)

Others

Oryzabase (17852)

KEGG (Os10t0100500-01)

Transcript

2775 bp

>Os10t0100500-01 Serine/threonine protein kinase-related domain containing protein.
TCCATCCATGGAGATACTTAGCCCGTCGCCGCCGCCCAGCCCCGGCCCCGCCTCCGCCTC
CGCCTCCGCCTCCGGCTCCGCCATGGATTCCTTCATCCACAGAGGTGCCGGCTGGCATTT
CCCCCGCCGCGACAACGTCGACGCGCGGGTCCATGTCGCCGTCGGGAGGTCGCCGGAGAA
GACGTTGGGCCTGCTGCGATGGGCCTTCCGCCGCTTCGCCTGCGCCCAAGTCGTCCTCGT
GCACGTCCACCAACCTTCTCCGCTCATCCCTACCCTCTTAGGCAAGATTCctgccgctca
agccaccgaagagctcgtgctgtcgcatcgcaaatccgagaaggacgaaatgaacaaGAT
CCTCCTCACCTACCTCACTTTCTGTCACAGGGCACAGGTTCAGGCAAGTCTTCTTGTCAC
GGAGAATGAACAAATCCATGATGGTATTATCACTTTGGTCAAAGATCATGGGATTACAAA
GCTTGTCATGGGTTCTACACCTGATACTTGCTTCAAGTTGAAAGCGAGCTATGGCAAAGC
ATCTTTTATGGCAAGGAATGCCCCATCATTTTGTGAAATCTGGTTTGTTTGGAGAGGAAG
ACACATTTGGACCAGAGAAGCAGCTGCAGCCATTGGCAACAATATCTCAGTTTACAATGA
AGATGATGTTATGATCAGGAAAAGAATCAGGTTCAGCTCTACTAGTAACAATGCTGAATC
CATACTTGATGAAGGATACATTTCATACGAGGCACAAACACCTGCTGATCGTTATGAAAT
CACCATTTCAGATAATGGTCAACCGAATGATTATGAATCTCTTGTTGATGCCAACCATTT
CTGCAATATTATTGTACCAAATTTGCAAAATGCACAGTCTGCATTTAACTCAACATTCCA
GCCTGGTTCTTCTGTAGACATGGAATCATTAGTGTTATATCCTCAGGAAATCTTGGATAA
AAATTTCAAGCAGGTCATTCTAGAAGCAGAGAGATCAAGGAAGGATGCTTTTGTTGAGCT
TCTCAAGCGCAAAGATACAGAGTCAAGAGTAGCCGGTGTTATTGCCAGGGCAAAAGCTTC
TGAGTTCGCTCAAAAACAAGAAATGAAAATGCGGGAGGAACTTGAAGCTTTGTTGACAGC
CACAAAAAAGCAGCATGAAGATCTTGCAGAAAATAAAGAAAAGGCTACAGAAGGGTTGGA
CTCTTCGATGAGAAAACTAGCCATCCTAGATGCACGTGCTAAAAGCATAGCTTTTCGGAT
GAATGAAGCTGTGGCAGAGCTGAAATTGATTCAATCTTCCATAGGAACACTCAATCAGGA
AATTCCCAAAAGAGAGAAGCTAGAACTTGTACATACTGACCAGGTTGAAAGGTGTGCATA
TAACCACATTATGTTACCAAATTGCAGTTCAACTGTTTGTGCTGATGACTTGTACAACTT
TAGAGAATTGACTTTGTCAGATATTAAAGCTGCAACATGCAAGTTCTCAGACAGCTTAAA
AGTACTGCCACGAGGTCTTGGATGTGTTTATAAAGGAGAGATTATGAACAGAAGTGTAAT
GATTTATAAGTTGCACTCGTGTATCATTCAGAGTTCGATGCAGTTCCAGCAAGAGGTCCA
CCTCATTAGCAAGGTGAGGCACCCTCACCTGGTGACTTTGATTGGGGCATGCCCGGATGC
ATTGTGTCTTGTCTATGAATACGTGCCAAACGGGAGCCTTCACGACCGCCTTTGGAGCAA
GTGCGGCATTCCTCAGTTGCCATGGAAAATCCGTGCACGTATTGTTGCTGAAATCTCAAG
TGCTCTATTCTTCTTGCATTCCTGTAAACCTCAGATGATTGTCCACGGTGACTTGAAGCT
TGAAAACATCCTTTTAGATGCCAACCTGCACTGCAAGATAGCTGATTGTGGTATTTCTCA
ATTATTCATGGAAGATGCCAAGGACGCAGACCCGGAATACCGGAGAAGCAAACCATTGAC
ACCCAAATCTGACATATACTCCTTTGGGATTGTGATACTCCAGTTACTAACTGGGAAGCA
GGCTGCAGGCCTTCCCAGCGAAGTAAGGCGTGCAATGTCCAGTGGAAAGCTATGGTCATT
GTTAGATCCAACAGCTGGAGAGTGGCCTCTGGAGGTGGCTCGAAGGTTAGCAGAGTTGGG
GCTCAAGTGCAGTGAGGCAGCAAGTCCAGAGCTGCTGACTCCAGAAACTGTGCGAGATCT
GGAACAGCTCCACCTGATGAGGGATAATAGACAAGTGCCCTCCTTCTTCCTGTGCCCGAT
CCTCAAGGAAGTGATGCATGATCCCCAGGTGGGGGCGGACGGGTTGACGTACGAAGGGCG
CGCCATTTCCGAGTTGATGGACAATGGCCCTCCAATCACCCCCAACCACGCCCTTCGTTT
TGCCATCCATGACTGGCTCTCTCAGAGATCAACTCCTTTCTGATTTTCCCCAAGGATCTG
GATTTTGTATGTACACATTGTTTATTTCATAGTCAGTCTGTTTGTTAGTAGCACATGCAT
GATGTAACGAAATAATAATAGAGTAAATATTTCAAGTTTCATGTATCGAGCAAATGTCAC
TGTACATATAGAGTGAGTTAGGAGCTATGTTCAGGGCAGTCGGAGTATCTTGCTAGTTGC
CCGTTTGGTCTAAGTAGCAGTTGTCATGGGgttgacaaactaccccctccgtttctttac
ttatgtaagatgctttgatttttttatcagttaaagttcaatcaaatttatagaaaacat
agttacatttttaac

CDS

2436 bp

>Os10t0100500-01 Serine/threonine protein kinase-related domain containing protein.
ATGGAGATACTTAGCCCGTCGCCGCCGCCCAGCCCCGGCCCCGCCTCCGCCTCCGCCTCC
GCCTCCGGCTCCGCCATGGATTCCTTCATCCACAGAGGTGCCGGCTGGCATTTCCCCCGC
CGCGACAACGTCGACGCGCGGGTCCATGTCGCCGTCGGGAGGTCGCCGGAGAAGACGTTG
GGCCTGCTGCGATGGGCCTTCCGCCGCTTCGCCTGCGCCCAAGTCGTCCTCGTGCACGTC
CACCAACCTTCTCCGCTCATCCCTACCCTCTTAGGCAAGATTCctgccgctcaagccacc
gaagagctcgtgctgtcgcatcgcaaatccgagaaggacgaaatgaacaaGATCCTCCTC
ACCTACCTCACTTTCTGTCACAGGGCACAGGTTCAGGCAAGTCTTCTTGTCACGGAGAAT
GAACAAATCCATGATGGTATTATCACTTTGGTCAAAGATCATGGGATTACAAAGCTTGTC
ATGGGTTCTACACCTGATACTTGCTTCAAGTTGAAAGCGAGCTATGGCAAAGCATCTTTT
ATGGCAAGGAATGCCCCATCATTTTGTGAAATCTGGTTTGTTTGGAGAGGAAGACACATT
TGGACCAGAGAAGCAGCTGCAGCCATTGGCAACAATATCTCAGTTTACAATGAAGATGAT
GTTATGATCAGGAAAAGAATCAGGTTCAGCTCTACTAGTAACAATGCTGAATCCATACTT
GATGAAGGATACATTTCATACGAGGCACAAACACCTGCTGATCGTTATGAAATCACCATT
TCAGATAATGGTCAACCGAATGATTATGAATCTCTTGTTGATGCCAACCATTTCTGCAAT
ATTATTGTACCAAATTTGCAAAATGCACAGTCTGCATTTAACTCAACATTCCAGCCTGGT
TCTTCTGTAGACATGGAATCATTAGTGTTATATCCTCAGGAAATCTTGGATAAAAATTTC
AAGCAGGTCATTCTAGAAGCAGAGAGATCAAGGAAGGATGCTTTTGTTGAGCTTCTCAAG
CGCAAAGATACAGAGTCAAGAGTAGCCGGTGTTATTGCCAGGGCAAAAGCTTCTGAGTTC
GCTCAAAAACAAGAAATGAAAATGCGGGAGGAACTTGAAGCTTTGTTGACAGCCACAAAA
AAGCAGCATGAAGATCTTGCAGAAAATAAAGAAAAGGCTACAGAAGGGTTGGACTCTTCG
ATGAGAAAACTAGCCATCCTAGATGCACGTGCTAAAAGCATAGCTTTTCGGATGAATGAA
GCTGTGGCAGAGCTGAAATTGATTCAATCTTCCATAGGAACACTCAATCAGGAAATTCCC
AAAAGAGAGAAGCTAGAACTTGTACATACTGACCAGGTTGAAAGGTGTGCATATAACCAC
ATTATGTTACCAAATTGCAGTTCAACTGTTTGTGCTGATGACTTGTACAACTTTAGAGAA
TTGACTTTGTCAGATATTAAAGCTGCAACATGCAAGTTCTCAGACAGCTTAAAAGTACTG
CCACGAGGTCTTGGATGTGTTTATAAAGGAGAGATTATGAACAGAAGTGTAATGATTTAT
AAGTTGCACTCGTGTATCATTCAGAGTTCGATGCAGTTCCAGCAAGAGGTCCACCTCATT
AGCAAGGTGAGGCACCCTCACCTGGTGACTTTGATTGGGGCATGCCCGGATGCATTGTGT
CTTGTCTATGAATACGTGCCAAACGGGAGCCTTCACGACCGCCTTTGGAGCAAGTGCGGC
ATTCCTCAGTTGCCATGGAAAATCCGTGCACGTATTGTTGCTGAAATCTCAAGTGCTCTA
TTCTTCTTGCATTCCTGTAAACCTCAGATGATTGTCCACGGTGACTTGAAGCTTGAAAAC
ATCCTTTTAGATGCCAACCTGCACTGCAAGATAGCTGATTGTGGTATTTCTCAATTATTC
ATGGAAGATGCCAAGGACGCAGACCCGGAATACCGGAGAAGCAAACCATTGACACCCAAA
TCTGACATATACTCCTTTGGGATTGTGATACTCCAGTTACTAACTGGGAAGCAGGCTGCA
GGCCTTCCCAGCGAAGTAAGGCGTGCAATGTCCAGTGGAAAGCTATGGTCATTGTTAGAT
CCAACAGCTGGAGAGTGGCCTCTGGAGGTGGCTCGAAGGTTAGCAGAGTTGGGGCTCAAG
TGCAGTGAGGCAGCAAGTCCAGAGCTGCTGACTCCAGAAACTGTGCGAGATCTGGAACAG
CTCCACCTGATGAGGGATAATAGACAAGTGCCCTCCTTCTTCCTGTGCCCGATCCTCAAG
GAAGTGATGCATGATCCCCAGGTGGGGGCGGACGGGTTGACGTACGAAGGGCGCGCCATT
TCCGAGTTGATGGACAATGGCCCTCCAATCACCCCCAACCACGCCCTTCGTTTTGCCATC
CATGACTGGCTCTCTCAGAGATCAACTCCTTTCTGA

Protein

812 aa

>Os10t0100500-01 Serine/threonine protein kinase-related domain containing protein.
MEILSPSPPPSPGPASASASASGSAMDSFIHRGAGWHFPRRDNVDARVHVAVGRSPEKTL
GLLRWAFRRFACAQVVLVHVHQPSPLIPTLLGKIPAAQATEELVLSHRKSEKDEMNKILL
TYLTFCHRAQVQASLLVTENEQIHDGIITLVKDHGITKLVMGSTPDTCFKLKASYGKASF
MARNAPSFCEIWFVWRGRHIWTREAAAAIGNNISVYNEDDVMIRKRIRFSSTSNNAESIL
DEGYISYEAQTPADRYEITISDNGQPNDYESLVDANHFCNIIVPNLQNAQSAFNSTFQPG
SSVDMESLVLYPQEILDKNFKQVILEAERSRKDAFVELLKRKDTESRVAGVIARAKASEF
AQKQEMKMREELEALLTATKKQHEDLAENKEKATEGLDSSMRKLAILDARAKSIAFRMNE
AVAELKLIQSSIGTLNQEIPKREKLELVHTDQVERCAYNHIMLPNCSSTVCADDLYNFRE
LTLSDIKAATCKFSDSLKVLPRGLGCVYKGEIMNRSVMIYKLHSCIIQSSMQFQQEVHLI
SKVRHPHLVTLIGACPDALCLVYEYVPNGSLHDRLWSKCGIPQLPWKIRARIVAEISSAL
FFLHSCKPQMIVHGDLKLENILLDANLHCKIADCGISQLFMEDAKDADPEYRRSKPLTPK
SDIYSFGIVILQLLTGKQAAGLPSEVRRAMSSGKLWSLLDPTAGEWPLEVARRLAELGLK
CSEAASPELLTPETVRDLEQLHLMRDNRQVPSFFLCPILKEVMHDPQVGADGLTYEGRAI
SELMDNGPPITPNHALRFAIHDWLSQRSTPF*

5'UTR

chr10:67119..67125 (+ strand) : 7 bp

CDS

chr10:67126..67396 (+ strand) : 271 bp

chr10:67556..67674 (+ strand) : 119 bp

chr10:67787..67896 (+ strand) : 110 bp

chr10:69945..70383 (+ strand) : 439 bp

chr10:70479..70601 (+ strand) : 123 bp

chr10:70773..71318 (+ strand) : 546 bp

chr10:71697..72366 (+ strand) : 670 bp

chr10:72480..72637 (+ strand) : 158 bp

3'UTR

chr10:72638..72969 (+ strand) : 332 bp

FASTA

>Os10t0100500-01 class=Sequence position=chr10:67119..72969 (+ strand)
TCCATCCATG GAGATACTTA GCCCGTCGCC GCCGCCCAGC CCCGGCCCCG CCTCCGCCTC CGCCTCCGCC TCCGGCTCCG
CCATGGATTC CTTCATCCAC AGAGGTGCCG GCTGGCATTT CCCCCGCCGC GACAACGTCG ACGCGCGGGT CCATGTCGCC
GTCGGGAGGT CGCCGGAGAA GACGTTGGGC CTGCTGCGAT GGGCCTTCCG CCGCTTCGCC TGCGCCCAAG TCGTCCTCGT
GCACGTCCAC CAACCTTCTC CGCTCATCCC TACCCTCTGT ACGATTCTAG TGTTTCAATT CCTTCTTTCT TTCTTTCTTT
CTTGGAGTAT TTATTTATTT ATGAGTTAAT TTCTCGATTC TTCCTTCTCC GCCGCTCACG GCTCACCCAT CACATCTTCT
TCTTCTTCTT CTTCTTCTTC TTCTTCTTCT TCTTCAGTAG GCAAGATTCc tgccgctcaa gccaccgaag agctcgtgct
gtcgcatcgc aaatccgaga aggacgaaat gaacaaGATC CTCCTCACCT ACCTCACTTT CTGTCACAGG GCACAGGTAA
GTGCTACTCA CCTTCTTCTC CAACCTTTTT TTTATCTAGG AGAAACATCA CAGATTCAAT TTTTATGGGT GTGCGACGCT
AATTAATCGG GCTTTTGCTC TGCCACAGGT TCAGGCAAGT CTTCTTGTCA CGGAGAATGA ACAAATCCAT GATGGTATTA
TCACTTTGGT CAAAGATCAT GGGATTACAA AGCTTGTCAT GGGTTCTACA CCTGATACGT ATGTACTACT TCAATTTTCA
TCAATTGCGT GCTAACAAAA CACCCTTCTT GATAGTGCCA TCTCTATAAA ACAATTCAAA CTCTCTGTTC TACACAAGGA
ATTCTACTGT TAGTTCAAAT ATATCGCTGC TAAAATTCGT GTATCCTGTT CTTACAAACC TGCTTCAAAC CAGCCGTTTT
CAGTCCCCAC ATGCTGTCAT GTTATGCATT CTTTATTAAT GGTCACGGGC ATATGGCTAA CAGCAGGTCC TACTACCATG
ATTTGAAGTT TCATCTTTGG CCCCTAGCTG ATGGTCCAAT CAGTGGCGGC GCCAAGAGTT TTGTGAAGCC AAGGCGGGTC
TAACTGAAAC TATTACACTC AAAACATGTT CATTTTCCAT ATATCACCAT TAAAATTTTC TACCATTTTT TTTTATAGAA
ATGTGACCCA AAATACTTGT AAATATGTTT ATGGATGAAA GGATACTACG ACGAGAACGT CCAAGCTTAA TTCGATGATT
CACTAATACG CTGAAATATA AATTTACTAG GTAAAAGCTT TTATCAATAT CAATGGAACA TGGAAGAAAA TAACAAATAC
TATTCATATT CAGAGAAACG TACCCACTAA TACACCTATA TTGTGTCTAC ATGGACATGT TCAATACAAG TAAATGTCCG
TGTGATTTGA TAACGACAGT GAGTCTAGTA CTTGTGGGGG CAGGCAGGCC ATAGGCAGCT GAGGCCCAAG GCCCAATCGC
CTCCTGCAGC ATGGCTTGCC GTATTTAATT AATAACATGC AAATCTTTCC CAGGAATTAA TCTGTTTCAG CCAAGGATTA
GCGCTAGATA ATATGGGTTC ATCGCTGTGA AGCCTGGGCA TCCGCCCCTG CTGCCCGGGA GGTGAATCCG CCTCTGGGTC
CAATTACGTT GTTACTAATA CCCGTTCTAA CTTGCTGTTC TTGTGGTTGT CATGTGTATT CTTCATCAAA ATTTCAATAC
TGAACAAAGC AGCTATCAGT ATTGGAAAAC TAGGTAGTCT AGTCCCCAAG TATCTACTTC AAGCTAGAAA AGTTCAGCCC
AAGAACATAA CAGAAATTGG AAATAATACT AATAACTCAA ATTAATCTAA TACTCTCTTT ATCAACTTAT GGAGCATGAA
GGAAAACAAG AAACAAAAAA ACTTGATCTC AGGTGCTCGA TAGACTAGAT ATTTTTTGTG TGTATTCTAC ACCCTTCATT
GCTCGTAACC ATTCTTAGTA ACAATTTCCA GCACTGGCAT CTTCCAACAG CACCTCGATG GTTTTGAAAC TTTGATCTCC
CAACTTGATG TTAACATTGT CTGCCCCAAC TTGATGTAGC ACCAAAATCT TGCAACCAAC ATCAACTGGA CAATGCACCA
CATGCTCCTC ACCTaggatt gcaatttcgg atcgaaattt tggtaattcc ggaccccccc ccacgcggca agtgattata
tcggccgttt tttttttgtt tttctcaaat ttctgtgaat ttggtcaaaa tttaatcaaa ttcagttaaa ttatgCTAAA
ATTTAAAAAA AAATCGGTCC AAAAAGTGCC AAAAATCCTG ATTTTCAGGA ATTTCGGTAG AACCAAAATG AGCGAAATTT
CGGATGAAAT CAAAATTGAA AACCCTGTCC TCAACCACCT TATGTCAAGT ATTCCCGTGC TCACTCACCT AGATCCATCA
TTATTTGTTT AACCATGCCT CATGAATCCA CATAATTTCA GTAAAAAGTG AGCAAACTTG AATACAATTA AACCCATTGT
CAATTACATG TCACATCAAC TTGTTGATAT GAGTATCATC TAACGTAATC TTACAATTTT GTTCGGAATG TATGGTTATA
ATGATCCCAA GAAATAGATC ATCTAACTGT AATGATATGT ATGCAGATGG TTCCGTAGTG TTTGTGGGAT CCTATGATAT
GTACTAGGAT ATTGACATCC CATAGTGACC ACTATATTCC CTTTCTTTTG TTTTATTTCG GGGTGGGTGT CCCTGAAAAT
TTGAACTCTC TCTACCTGTA ATGCAGTTGC TTCAAGTTGA AAGCGAGCTA TGGCAAAGCA TCTTTTATGG CAAGGAATGC
CCCATCATTT TGTGAAATCT GGTTTGTTTG GAGAGGAAGA CACATTTGGA CCAGAGAAGC AGCTGCAGCC ATTGGCAACA
ATATCTCAGT TTACAATGAA GATGATGTTA TGATCAGGAA AAGAATCAGG TTCAGCTCTA CTAGTAACAA TGCTGAATCC
ATACTTGATG AAGGATACAT TTCATACGAG GCACAAACAC CTGCTGATCG TTATGAAATC ACCATTTCAG ATAATGGTCA
ACCGAATGAT TATGAATCTC TTGTTGATGC CAACCATTTC TGCAATATTA TTGTACCAAA TTTGCAAAAT GCACAGTCTG
CATTTAACTC AACATTCCAG CCTGGTTCTT CTGTAGACAT GGAATCATTA GTGTTATATC CTCAGGTGCT CTCCTGCTAC
ATTGACATGT TCATTGATAA TTTTGTAATT AAAGGATGAT CCTTTTTTTC AATTTAAATA CTGATGGTAT TATCTGTCAG
GAAATCTTGG ATAAAAATTT CAAGCAGGTC ATTCTAGAAG CAGAGAGATC AAGGAAGGAT GCTTTTGTTG AGCTTCTCAA
GCGCAAAGAT ACAGAGTCAA GAGTAGCCGG TGTTATTGCC AGGGTATGCA AACCACTTAT CCTATCTTGT ATTTTAAACT
GCACGGTTCC TCTGCAGTAT AACATTATTG GGAAACCAAA CGGAAGTTTT AGATTCTTTA ACATTGATTT TGAATAATGT
GGTGAAAATT ACATATGCAT TCCTTTGTTG ATCTGGCTTG TGCTTCTTGA GCAGGCAAAA GCTTCTGAGT TCGCTCAAAA
ACAAGAAATG AAAATGCGGG AGGAACTTGA AGCTTTGTTG ACAGCCACAA AAAAGCAGCA TGAAGATCTT GCAGAAAATA
AAGAAAAGGC TACAGAAGGG TTGGACTCTT CGATGAGAAA ACTAGCCATC CTAGATGCAC GTGCTAAAAG CATAGCTTTT
CGGATGAATG AAGCTGTGGC AGAGCTGAAA TTGATTCAAT CTTCCATAGG AACACTCAAT CAGGAAATTC CCAAAAGAGA
GAAGCTAGAA CTTGTACATA CTGACCAGGT TGAAAGGTGT GCATATAACC ACATTATGTT ACCAAATTGC AGTTCAACTG
TTTGTGCTGA TGACTTGTAC AACTTTAGAG AATTGACTTT GTCAGATATT AAAGCTGCAA CATGCAAGTT CTCAGACAGC
TTAAAAGTAC TGCCACGAGG TCTTGGATGT GTTTATAAAG GAGAGATTAT GAACAGAAGT GTAATGATTT ATAAGTTGCA
CTCGTGTATC ATTCAGAGTT CGATGCAGTT CCAGCAAGAG GTACTCTCTG TTACCCTGTT TATCATGCTG GTTGATATAT
TAGTGATACA TAGCTCAATG AAACTGCTAA AAGTTATTTT GCAGCTCCAC ATATCACTTG AAACTCTATG GGGCTTGTTG
AATTATGTAG GATTTGTTTT TTTTCTTCTA TTTATCTAGA TAGATTACTT GTTGTGTCAT TTGTCATAAT AAAAACCAAA
AATTATCTCT TTGCACTATG ACCAAGCAGG AGATGATGTG GGCCAATCAT TCCAAGTATA TGCTTGCTTG TCTTGTTTAT
CACATAACTT ATCGTGCTAA GTGTTTATAA AAACCTAGGA GCATATAGCA ATAGCAGTTA TTTAGCAGAA GGTAGTTATT
TCACATTGTT TTTGGCAGGT CCACCTCATT AGCAAGGTGA GGCACCCTCA CCTGGTGACT TTGATTGGGG CATGCCCGGA
TGCATTGTGT CTTGTCTATG AATACGTGCC AAACGGGAGC CTTCACGACC GCCTTTGGAG CAAGTGCGGC ATTCCTCAGT
TGCCATGGAA AATCCGTGCA CGTATTGTTG CTGAAATCTC AAGTGCTCTA TTCTTCTTGC ATTCCTGTAA ACCTCAGATG
ATTGTCCACG GTGACTTGAA GCTTGAAAAC ATCCTTTTAG ATGCCAACCT GCACTGCAAG ATAGCTGATT GTGGTATTTC
TCAATTATTC ATGGAAGATG CCAAGGACGC AGACCCGGAA TACCGGAGAA GCAAACCATT GACACCCAAA TCTGACATAT
ACTCCTTTGG GATTGTGATA CTCCAGTTAC TAACTGGGAA GCAGGCTGCA GGCCTTCCCA GCGAAGTAAG GCGTGCAATG
TCCAGTGGAA AGCTATGGTC ATTGTTAGAT CCAACAGCTG GAGAGTGGCC TCTGGAGGTG GCTCGAAGGT TAGCAGAGTT
GGGGCTCAAG TGCAGTGAGG CAGCAAGTCC AGAGCTGCTG ACTCCAGAAA CTGTGCGAGA TCTGGAACAG CTCCACCTGA
TGAGGGATAA TAGACAAGTG CCCTCCTTCT TCCTGTGCCC GATCCTCAAG GCAAGAACGA AACCTAAGAA CATCGATAGG
GCAGAAGCCC ATAAGTAACC CAAAATATCT ACTAATAATA ATGCGGTAGT AATGTGTTTT TTTTTTCATT CTAATTTGTG
CAGGAAGTGA TGCATGATCC CCAGGTGGGG GCGGACGGGT TGACGTACGA AGGGCGCGCC ATTTCCGAGT TGATGGACAA
TGGCCCTCCA ATCACCCCCA ACCACGCCCT TCGTTTTGCC ATCCATGACT GGCTCTCTCA GAGATCAACT CCTTTCTGAT
TTTCCCCAAG GATCTGGATT TTGTATGTAC ACATTGTTTA TTTCATAGTC AGTCTGTTTG TTAGTAGCAC ATGCATGATG
TAACGAAATA ATAATAGAGT AAATATTTCA AGTTTCATGT ATCGAGCAAA TGTCACTGTA CATATAGAGT GAGTTAGGAG
CTATGTTCAG GGCAGTCGGA GTATCTTGCT AGTTGCCCGT TTGGTCTAAG TAGCAGTTGT CATGGGgttg acaaactacc
ccctccgttt ctttacttat gtaagatgct ttgatttttt tatcagttaa agttcaatca aatttataga aaacatagtt
acatttttaa c

Locus: Os10g0100500

Loading...

Locus: Os10g0100500

Loading...