Os10t0100500-02

Locus

Os10g0100500

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK285

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 285

Oryzabase Gene Symbol Synonym(s)

OsPUB61, OsRLCK285

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 61, U-box protein 61, Receptor-like Cytoplasmic Kinase 285

Transcript Evidence

AK061113 (DDBJ, Best hit)

Protein Evidence

B9G587 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

U box domain (IPR003613)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

006-207-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0100500-02)

RiceXPro (AK061113)

Others

Oryzabase (17852)

KEGG (Os10t0100500-02)

Transcript

1101 bp

>Os10t0100500-02 Similar to predicted protein.
TGCAACATGCAAGTTCTCAGACAGCTTAAAAGTACTGCCACGAGGTCTTGGATGTGTTTA
TAAAGGAGAGATTATGAACAGAAGTGTAATGATTTATAAGTTGCACTCGTGTATCATTCA
GAGTTCGATGCAGTTCCAGCAAGAGGTCCACCTCATTAGCAAGGTGAGGCACCCTCACCT
GGTGACTTTGATTGGGGCATGCCCGGATGCATTGTGTCTTGTCTATGAATACGTGCCAAA
CGGGAGCCTTCACGACCGCCTTTGGAGCAAGTGCGGCATTCCTCAGTTGCCATGGAAAAT
CCGTGCACGTATTGTTGCTGAAATCTCAAGTGCTCTATTCTTCTTGCATTCCTGTAAACC
TCAGATGATTGTCCACGGTGACTTGAAGCTTGAAAACATCCTTTTAGATGCCAACCTGCA
CTGCAAGATAGCTGATTGTGGTATTTCTCAATTATTCATGGAAGATGCCAAGGACGCAGA
CCCGGAATACCGGAGAAGCAAACCATTGACACCCAAATCTGACATATACTCCTTTGGGAT
TGTGATACTCCAGTTACTAACTGGGAAGCAGGCTGCAGGCCTTCCCAGCGAAGTAAGGCG
TGCAATGTCCAGTGGAAAGCTATGGTCATTGTTAGATCCAACAGCTGGAGAGTGGCCTCT
GGAGGTGGCTCGAAGGTTAGCAGAGTTGGGGCTCAAGTGCAGTGAGGCAGCAAGTCCAGA
GCTGCTGACTCCAGAAACTGTGCGAGATCTGGAACAGCTCCACCTGATGAGGGATAATAG
ACAAGTGCCCTCCTTCTTCCTGTGCCCGATCCTCAAGGAAGTGATGCATGATCCCCAGGT
GGGGGCGGACGGGTTGACGTACGAAGGGCGCGCCATTTCCGAGTTGATGGACAATGGCCC
TCCAATCACCCCCAACCACGCCCTTCGTTTTGCCATCCATGACTGGCTCTCTCAGAGATC
AACTCCTTTCTGATTTTCCCCAAGGATCTGGATTTTGTATGTACACATTGTTTATTTCAT
AGTCAGTCTGTTTGTTAGTAGCACATGCATGATGTAACGAAATAATAATAGAGTAAATAT
TTCAAGTTTCATGTATCGAGC

CDS

972 bp

>Os10t0100500-02 Similar to predicted protein.
GCAACATGCAAGTTCTCAGACAGCTTAAAAGTACTGCCACGAGGTCTTGGATGTGTTTAT
AAAGGAGAGATTATGAACAGAAGTGTAATGATTTATAAGTTGCACTCGTGTATCATTCAG
AGTTCGATGCAGTTCCAGCAAGAGGTCCACCTCATTAGCAAGGTGAGGCACCCTCACCTG
GTGACTTTGATTGGGGCATGCCCGGATGCATTGTGTCTTGTCTATGAATACGTGCCAAAC
GGGAGCCTTCACGACCGCCTTTGGAGCAAGTGCGGCATTCCTCAGTTGCCATGGAAAATC
CGTGCACGTATTGTTGCTGAAATCTCAAGTGCTCTATTCTTCTTGCATTCCTGTAAACCT
CAGATGATTGTCCACGGTGACTTGAAGCTTGAAAACATCCTTTTAGATGCCAACCTGCAC
TGCAAGATAGCTGATTGTGGTATTTCTCAATTATTCATGGAAGATGCCAAGGACGCAGAC
CCGGAATACCGGAGAAGCAAACCATTGACACCCAAATCTGACATATACTCCTTTGGGATT
GTGATACTCCAGTTACTAACTGGGAAGCAGGCTGCAGGCCTTCCCAGCGAAGTAAGGCGT
GCAATGTCCAGTGGAAAGCTATGGTCATTGTTAGATCCAACAGCTGGAGAGTGGCCTCTG
GAGGTGGCTCGAAGGTTAGCAGAGTTGGGGCTCAAGTGCAGTGAGGCAGCAAGTCCAGAG
CTGCTGACTCCAGAAACTGTGCGAGATCTGGAACAGCTCCACCTGATGAGGGATAATAGA
CAAGTGCCCTCCTTCTTCCTGTGCCCGATCCTCAAGGAAGTGATGCATGATCCCCAGGTG
GGGGCGGACGGGTTGACGTACGAAGGGCGCGCCATTTCCGAGTTGATGGACAATGGCCCT
CCAATCACCCCCAACCACGCCCTTCGTTTTGCCATCCATGACTGGCTCTCTCAGAGATCA
ACTCCTTTCTGA

Protein

324 aa

>Os10t0100500-02 Similar to predicted protein.
ATCKFSDSLKVLPRGLGCVYKGEIMNRSVMIYKLHSCIIQSSMQFQQEVHLISKVRHPHL
VTLIGACPDALCLVYEYVPNGSLHDRLWSKCGIPQLPWKIRARIVAEISSALFFLHSCKP
QMIVHGDLKLENILLDANLHCKIADCGISQLFMEDAKDADPEYRRSKPLTPKSDIYSFGI
VILQLLTGKQAAGLPSEVRRAMSSGKLWSLLDPTAGEWPLEVARRLAELGLKCSEAASPE
LLTPETVRDLEQLHLMRDNRQVPSFFLCPILKEVMHDPQVGADGLTYEGRAISELMDNGP
PITPNHALRFAIHDWLSQRSTPF*

5'UTR

chr10:71174..71174 (+ strand) : 1 bp

CDS

chr10:71175..71318 (+ strand) : 144 bp

chr10:71697..72366 (+ strand) : 670 bp

chr10:72480..72637 (+ strand) : 158 bp

3'UTR

chr10:72638..72765 (+ strand) : 128 bp

FASTA

>Os10t0100500-02 class=Sequence position=chr10:71174..72765 (+ strand)
TGCAACATGC AAGTTCTCAG ACAGCTTAAA AGTACTGCCA CGAGGTCTTG GATGTGTTTA TAAAGGAGAG ATTATGAACA
GAAGTGTAAT GATTTATAAG TTGCACTCGT GTATCATTCA GAGTTCGATG CAGTTCCAGC AAGAGGTACT CTCTGTTACC
CTGTTTATCA TGCTGGTTGA TATATTAGTG ATACATAGCT CAATGAAACT GCTAAAAGTT ATTTTGCAGC TCCACATATC
ACTTGAAACT CTATGGGGCT TGTTGAATTA TGTAGGATTT GTTTTTTTTC TTCTATTTAT CTAGATAGAT TACTTGTTGT
GTCATTTGTC ATAATAAAAA CCAAAAATTA TCTCTTTGCA CTATGACCAA GCAGGAGATG ATGTGGGCCA ATCATTCCAA
GTATATGCTT GCTTGTCTTG TTTATCACAT AACTTATCGT GCTAAGTGTT TATAAAAACC TAGGAGCATA TAGCAATAGC
AGTTATTTAG CAGAAGGTAG TTATTTCACA TTGTTTTTGG CAGGTCCACC TCATTAGCAA GGTGAGGCAC CCTCACCTGG
TGACTTTGAT TGGGGCATGC CCGGATGCAT TGTGTCTTGT CTATGAATAC GTGCCAAACG GGAGCCTTCA CGACCGCCTT
TGGAGCAAGT GCGGCATTCC TCAGTTGCCA TGGAAAATCC GTGCACGTAT TGTTGCTGAA ATCTCAAGTG CTCTATTCTT
CTTGCATTCC TGTAAACCTC AGATGATTGT CCACGGTGAC TTGAAGCTTG AAAACATCCT TTTAGATGCC AACCTGCACT
GCAAGATAGC TGATTGTGGT ATTTCTCAAT TATTCATGGA AGATGCCAAG GACGCAGACC CGGAATACCG GAGAAGCAAA
CCATTGACAC CCAAATCTGA CATATACTCC TTTGGGATTG TGATACTCCA GTTACTAACT GGGAAGCAGG CTGCAGGCCT
TCCCAGCGAA GTAAGGCGTG CAATGTCCAG TGGAAAGCTA TGGTCATTGT TAGATCCAAC AGCTGGAGAG TGGCCTCTGG
AGGTGGCTCG AAGGTTAGCA GAGTTGGGGC TCAAGTGCAG TGAGGCAGCA AGTCCAGAGC TGCTGACTCC AGAAACTGTG
CGAGATCTGG AACAGCTCCA CCTGATGAGG GATAATAGAC AAGTGCCCTC CTTCTTCCTG TGCCCGATCC TCAAGGCAAG
AACGAAACCT AAGAACATCG ATAGGGCAGA AGCCCATAAG TAACCCAAAA TATCTACTAA TAATAATGCG GTAGTAATGT
GTTTTTTTTT TCATTCTAAT TTGTGCAGGA AGTGATGCAT GATCCCCAGG TGGGGGCGGA CGGGTTGACG TACGAAGGGC
GCGCCATTTC CGAGTTGATG GACAATGGCC CTCCAATCAC CCCCAACCAC GCCCTTCGTT TTGCCATCCA TGACTGGCTC
TCTCAGAGAT CAACTCCTTT CTGATTTTCC CCAAGGATCT GGATTTTGTA TGTACACATT GTTTATTTCA TAGTCAGTCT
GTTTGTTAGT AGCACATGCA TGATGTAACG AAATAATAAT AGAGTAAATA TTTCAAGTTT CATGTATCGA GC

Locus: Os10g0100500

Loading...

Locus: Os10g0100500

Loading...