Os10t0112100-01

Locus

Os10g0112100

Description

Member of the PLAC8 domain-containing protein family, Maintenance of metal ion homeostasis and grain weight, Negative regulation of plant height

RAP-DB Gene Symbol Synonym(s)

OsFWL5, OsPcr1, PCR1, OsPCR1

RAP-DB Gene Name Synonym(s)

FW2.2-like 5, Plant cadmium resistance 1

CGSNL Gene Symbol

PCR1

CGSNL Gene Name

PLANT CADMIUM RESISTANCE 1

Oryzabase Gene Symbol Synonym(s)

OsFWL5, FWL5, OsPcr1, OsPCR1, OsFWL5/OsPCR1

Oryzabase Gene Name Synonym(s)

FW2.2-like 5, fruit-weight 2.2-like 5, Plant cadmium resistance 1

Transcript Evidence

AK108480

Protein Evidence

Q33BF6

Literature

PMID: 25854544

PMID: 23793979

Note

Manual Curation

December 2, 2016

Functional domain (InterPro)

PLAC8 motif-containing protein (IPR006461)

Full-length cDNA

002-143-F03 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0112100-01)

RiceXPro (AK108480)

Others

Oryzabase (13474)

KEGG (Os10t0112100-01)

Transcript

781 bp

>Os10t0112100-01 Member of the PLAC8 domain-containing protein family, Maintenance of metal ion homeostasis and grain weight, Negative regulation of plant height
ACTTAAATCACATCTCAGGGACAGCAGGTAGCCATCCATTAGCTAGCTAGTCAAATTAAC
TTCTACACGGCCATGTATCCCCCTGATCCGTCCAAGTCCGGCGAGTCGTCGGCGGCGGCG
CCGGAGCCGGTGACCGGGATCCCCGTCGGCATGTTCTACCCTGCTCCGCCGATGGAGCGT
GTGGTGTCGTGCCGCATGGCGCCGGCGGCTGGAGGGGCGTGGACCACCGCCCTCTGCGAC
TGCGCCGACGACTGCAACACCTGTTGTATGGCGTGCTGGTGCCCGTGCATCCCTGTCGGC
CAGATCGCAGAAATCGTCGACAGGGGCTCATCATCGTGCGCGTTGAACGCGGTGCTGTAC
TGCCTGGTGTTCCACGTGTCGGCGGGGATGTGCCAGTGGGTGTACTCGTGCGCCTACCGC
GCTCGCCTCCGGGCGGCGTACGACCTGCCGGAGACGCCCTGCTCCGACTGCCTCGTCACC
TTCTGCTGCCAGACCTGCTCCATCGCACAGATGCACCGTGAGCTCAAGAACCGCGGCCAC
GACCCTAACCTTGGATGGGAGGTGAACTCGCGGAGGACGATGATGACTCCTCCCCAACAC
CAAGCGATGGAAGGAATGACAACTCCCTCATAACAACTACTCATCATCACCTCTCGATCG
ACCAAACAATACATACACACGATATATAGCTATTACAAGCATGTACACCCTTTGATTTAT
AAAGTGGCAATACATATATAGATGTGTGACGCTTATTTTATTTTATAAACATATTTTTTT
T

CDS

561 bp

>Os10t0112100-01 Member of the PLAC8 domain-containing protein family, Maintenance of metal ion homeostasis and grain weight, Negative regulation of plant height
ATGTATCCCCCTGATCCGTCCAAGTCCGGCGAGTCGTCGGCGGCGGCGCCGGAGCCGGTG
ACCGGGATCCCCGTCGGCATGTTCTACCCTGCTCCGCCGATGGAGCGTGTGGTGTCGTGC
CGCATGGCGCCGGCGGCTGGAGGGGCGTGGACCACCGCCCTCTGCGACTGCGCCGACGAC
TGCAACACCTGTTGTATGGCGTGCTGGTGCCCGTGCATCCCTGTCGGCCAGATCGCAGAA
ATCGTCGACAGGGGCTCATCATCGTGCGCGTTGAACGCGGTGCTGTACTGCCTGGTGTTC
CACGTGTCGGCGGGGATGTGCCAGTGGGTGTACTCGTGCGCCTACCGCGCTCGCCTCCGG
GCGGCGTACGACCTGCCGGAGACGCCCTGCTCCGACTGCCTCGTCACCTTCTGCTGCCAG
ACCTGCTCCATCGCACAGATGCACCGTGAGCTCAAGAACCGCGGCCACGACCCTAACCTT
GGATGGGAGGTGAACTCGCGGAGGACGATGATGACTCCTCCCCAACACCAAGCGATGGAA
GGAATGACAACTCCCTCATAA

Protein

187 aa

>Os10t0112100-01 Member of the PLAC8 domain-containing protein family, Maintenance of metal ion homeostasis and grain weight, Negative regulation of plant height
MYPPDPSKSGESSAAAPEPVTGIPVGMFYPAPPMERVVSCRMAPAAGGAWTTALCDCADD
CNTCCMACWCPCIPVGQIAEIVDRGSSSCALNAVLYCLVFHVSAGMCQWVYSCAYRARLR
AAYDLPETPCSDCLVTFCCQTCSIAQMHRELKNRGHDPNLGWEVNSRRTMMTPPQHQAME
GMTTPS*

5'UTR

chr10:826238..826309 (- strand) : 72 bp

CDS

chr10:826048..826237 (- strand) : 190 bp

chr10:825809..825880 (- strand) : 72 bp

chr10:825463..825681 (- strand) : 219 bp

chr10:824983..825062 (- strand) : 80 bp

3'UTR

chr10:824835..824982 (- strand) : 148 bp

FASTA

>Os10t0112100-01 class=Sequence position=chr10:824835..826309 (- strand)
ACTTAAATCA CATCTCAGGG ACAGCAGGTA GCCATCCATT AGCTAGCTAG TCAAATTAAC TTCTACACGG CCATGTATCC
CCCTGATCCG TCCAAGTCCG GCGAGTCGTC GGCGGCGGCG CCGGAGCCGG TGACCGGGAT CCCCGTCGGC ATGTTCTACC
CTGCTCCGCC GATGGAGCGT GTGGTGTCGT GCCGCATGGC GCCGGCGGCT GGAGGGGCGT GGACCACCGC CCTCTGCGAC
TGCGCCGACG ACTGCAACAC CTGTAAGCTT TCTTTTTCTT CTTTAAGCAA ATTAGTTAAT ATCATTATTA ATTAGCAGTT
AGCCCATACA TATCAGCTTA ATTATCATGC TCCAAGTCTG TATACAACGA TTAATTATAT ATAATCTTTA TGAAATGAAT
TAATTAACGG ATGCATATAT ATGCTGCAGG TTGTATGGCG TGCTGGTGCC CGTGCATCCC TGTCGGCCAG ATCGCAGAAA
TCGTCGACAG GGGCTCATCA TGTAATTGAT TAACCTCATC GACTCAAATT CTCTTATCAT TAATATGATT TTACTGTGCA
GATCGATGCT GTTTGAAATT CCCCCAATTT TCATAATTTC TCAAATAGAT CCTGTACGTT TTGCACAGCG TGCGCGTTGA
ACGCGGTGCT GTACTGCCTG GTGTTCCACG TGTCGGCGGG GATGTGCCAG TGGGTGTACT CGTGCGCCTA CCGCGCTCGC
CTCCGGGCGG CGTACGACCT GCCGGAGACG CCCTGCTCCG ACTGCCTCGT CACCTTCTGC TGCCAGACCT GCTCCATCGC
ACAGATGCAC CGTGAGCTCA AGAACCGCGG CCACGACCCT AACCTTGGTA CGAGTATATT ATATTCTCTC TCTATCACCT
CTCAAACTCA ACTTTACATT GTATTTCCTA CTTCCAGTAG CTCAATCGTA CATCCATCTT ATTACAtaag tttaatgata
taatcataca tccatttcat ataagtcaaa aaaaagtttc ttcaacatat agtttttagc ttaaaagtgt aagggtgact
tatgacttta aaaaaatcaa acagaaaaaa atatctttgt ttaggtttag atttttgtga tcacagactg atttataagt
ctaaacaaga gggTCTAATA AGATATATAT TCCGATCTTC CAATCTTAAA AAAATTAGTA ACTTGTAACT CATTAATTCA
CTCAATGTGT TTAATTAATT TGTACTAATT AATGTGGGGT GATGAAGGAT GGGAGGTGAA CTCGCGGAGG ACGATGATGA
CTCCTCCCCA ACACCAAGCG ATGGAAGGAA TGACAACTCC CTCATAACAA CTACTCATCA TCACCTCTCG ATCGACCAAA
CAATACATAC ACACGATATA TAGCTATTAC AAGCATGTAC ACCCTTTGAT TTATAAAGTG GCAATACATA TATAGATGTG
TGACGCTTAT TTTATTTTAT AAACATATTT TTTTT

Locus: Os10g0112100

Loading...

Locus: Os10g0112100

Loading...