Os10t0115550-00

Locus

Os10g0115550

Description

Similar to gibberellin-regulated family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

FP101404 (DDBJ)

Protein Evidence

NP_180639.2 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Expression Databases

TENOR (Os10t0115550-00)

Transcript

245 bp

>Os10t0115550-00 Similar to gibberellin-regulated family protein.
ATTTACATTGTGTTTCTCTTTGTGCTATGTGTAGAGTGCCCAGGGAAATGCAGCTACCGT
TGCTCGGCCACATCTCACACGACGGTGTGCATGACATACTGCAACTACTGCTGCGAGAGG
TGCCTGTGTGTTCCATCCGGTACATACGGGAACAAGGAAGAATGCCCTTGCTACAACAAC
ATGAAAACCCAGGAAGGCAAACCAAAGTGCCCCTGAAATCAACTATGAACAATCGATCCA
TCCAT

CDS

216 bp

>Os10t0115550-00 Similar to gibberellin-regulated family protein.
ATTTACATTGTGTTTCTCTTTGTGCTATGTGTAGAGTGCCCAGGGAAATGCAGCTACCGT
TGCTCGGCCACATCTCACACGACGGTGTGCATGACATACTGCAACTACTGCTGCGAGAGG
TGCCTGTGTGTTCCATCCGGTACATACGGGAACAAGGAAGAATGCCCTTGCTACAACAAC
ATGAAAACCCAGGAAGGCAAACCAAAGTGCCCCTGA

Protein

71 aa

>Os10t0115550-00 Similar to gibberellin-regulated family protein.
IYIVFLFVLCVECPGKCSYRCSATSHTTVCMTYCNYCCERCLCVPSGTYGNKEECPCYNN
MKTQEGKPKCP*

CDS

chr10:1005275..1005490 (+ strand) : 216 bp

3'UTR

chr10:1005491..1005519 (+ strand) : 29 bp

FASTA

>Os10t0115550-00 class=Sequence position=chr10:1005275..1005519 (+ strand)
ATTTACATTG TGTTTCTCTT TGTGCTATGT GTAGAGTGCC CAGGGAAATG CAGCTACCGT TGCTCGGCCA CATCTCACAC
GACGGTGTGC ATGACATACT GCAACTACTG CTGCGAGAGG TGCCTGTGTG TTCCATCCGG TACATACGGG AACAAGGAAG
AATGCCCTTG CTACAACAAC ATGAAAACCC AGGAAGGCAA ACCAAAGTGC CCCTGAAATC AACTATGAAC AATCGATCCA
TCCAT

Locus: Os10g0115550

Loading...

Locus: Os10g0115550

Loading...