Os10t0116800-01

Locus

Os10g0116800

Description

Similar to Purple acid phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAP3B

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 3B

Oryzabase Gene Symbol Synonym(s)

OsPAP3b

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 3b

Transcript Evidence

AK110804 (DDBJ, Best hit)

Protein Evidence

B6TWW2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity (GO:0016787)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Full-length cDNA

002-171-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0116800-01)

RiceXPro (AK110804)

Others

Oryzabase (11377)

KEGG (Os10t0116800-01)

Transcript

1195 bp

>Os10t0116800-01 Similar to Purple acid phosphatase.
ATCAGCCATGGCTGTTGCACTCGCGCTCTTGGCTGCCATGTCGGCGCTCTCGTCGTGCAC
AAGTCCGGCCACCGCAGAGCTCACACGGCACGAGCACCCGGTGGCCGCCGGCGCGCCGCT
GCGCCTCCTCGTCGTCGGCGACTGGGGCCGGAAGGGCGGCTACAACCAGACAAGAGTTGC
AGAACAGATGGGGAAGGTTGCGGAGGAGACGGAGATCGACTTCGTCGTGTCAACCGGCGA
CAACTTCTTGGAGAACGGCCTCGCCGGCGTCGACGACATGGCGTTCCATGACTCCTTCAT
GGATGTCTACACGGCTCAGAGCTTGCACAAGCCATGGTACCTTGTTCTTGGAAACCATGA
CTACAGGGGAAATGTGCTAGCACAGATTGACCCAGCTCTGAGGAAGATCGACAGCAGGTT
CATCTGCATGAGATCCTTCATTGTCAGTGCAGGAATTGTCGATTTCTTCTTTGTCGACAC
GACCCCGTTTCAGCTCCAGTACTGGACTGATCCTGGAGAAGATCACTATGACTGGAGGGG
AGTCGCGCCTCGGGATGCGTACATCGCCAATCTCCTCGAGGATGTTGATGCTGCAATGAA
GAAATCAACTGCAACATGGAAGATAGCTGTAGGACATCATACCATGAGGAGTGTGAGTGC
CCATGGAGACACCCAGGAGCTCCTTGAGCTTCTCCTTCCTGTCCTCAAGGAAAACGGTGT
CGATTTCTACATCAATGGGCATGATCACTGCCTGGAGCACATCAGCAGCAGAAACAGTCC
AATTCAGTACTTCACTAGTGGAGGCGGATCAAAGGCATGGAGAGGCATTTTTCAACAAAA
CGAAGACAAGCTCCAGTTCTTCTATGATGGACAAGGGTTCCTGTCACTTGAGCTCAGTGA
GAACCGAGCTCGATTCGCCTTCTACGACGTTTTCGGTGAAGCTTTGTACCACTGGAGCTT
CAGCAAAGCTAATCTGCAGAAGGTTCAGTCCTCTGCTAGTGTAACTGAAGAATGAGAGAA
GCTGGAGCCTTCAGAATACATTCCCACACAGCTGAGTAGATGTCTACCTGCATAATTCTA
CTTGTACAATTATGTCACATTGTGCTCATCAATACTGGATTTGCTATGAATTAGCAAGTG
TTTGATTCTACTAGAGAAAGATCACAGAATGAAGCAGGTGTTTTTGCACGAAGCC

CDS

1008 bp

>Os10t0116800-01 Similar to Purple acid phosphatase.
ATGGCTGTTGCACTCGCGCTCTTGGCTGCCATGTCGGCGCTCTCGTCGTGCACAAGTCCG
GCCACCGCAGAGCTCACACGGCACGAGCACCCGGTGGCCGCCGGCGCGCCGCTGCGCCTC
CTCGTCGTCGGCGACTGGGGCCGGAAGGGCGGCTACAACCAGACAAGAGTTGCAGAACAG
ATGGGGAAGGTTGCGGAGGAGACGGAGATCGACTTCGTCGTGTCAACCGGCGACAACTTC
TTGGAGAACGGCCTCGCCGGCGTCGACGACATGGCGTTCCATGACTCCTTCATGGATGTC
TACACGGCTCAGAGCTTGCACAAGCCATGGTACCTTGTTCTTGGAAACCATGACTACAGG
GGAAATGTGCTAGCACAGATTGACCCAGCTCTGAGGAAGATCGACAGCAGGTTCATCTGC
ATGAGATCCTTCATTGTCAGTGCAGGAATTGTCGATTTCTTCTTTGTCGACACGACCCCG
TTTCAGCTCCAGTACTGGACTGATCCTGGAGAAGATCACTATGACTGGAGGGGAGTCGCG
CCTCGGGATGCGTACATCGCCAATCTCCTCGAGGATGTTGATGCTGCAATGAAGAAATCA
ACTGCAACATGGAAGATAGCTGTAGGACATCATACCATGAGGAGTGTGAGTGCCCATGGA
GACACCCAGGAGCTCCTTGAGCTTCTCCTTCCTGTCCTCAAGGAAAACGGTGTCGATTTC
TACATCAATGGGCATGATCACTGCCTGGAGCACATCAGCAGCAGAAACAGTCCAATTCAG
TACTTCACTAGTGGAGGCGGATCAAAGGCATGGAGAGGCATTTTTCAACAAAACGAAGAC
AAGCTCCAGTTCTTCTATGATGGACAAGGGTTCCTGTCACTTGAGCTCAGTGAGAACCGA
GCTCGATTCGCCTTCTACGACGTTTTCGGTGAAGCTTTGTACCACTGGAGCTTCAGCAAA
GCTAATCTGCAGAAGGTTCAGTCCTCTGCTAGTGTAACTGAAGAATGA

Protein

336 aa

>Os10t0116800-01 Similar to Purple acid phosphatase.
MAVALALLAAMSALSSCTSPATAELTRHEHPVAAGAPLRLLVVGDWGRKGGYNQTRVAEQ
MGKVAEETEIDFVVSTGDNFLENGLAGVDDMAFHDSFMDVYTAQSLHKPWYLVLGNHDYR
GNVLAQIDPALRKIDSRFICMRSFIVSAGIVDFFFVDTTPFQLQYWTDPGEDHYDWRGVA
PRDAYIANLLEDVDAAMKKSTATWKIAVGHHTMRSVSAHGDTQELLELLLPVLKENGVDF
YINGHDHCLEHISSRNSPIQYFTSGGGSKAWRGIFQQNEDKLQFFYDGQGFLSLELSENR
ARFAFYDVFGEALYHWSFSKANLQKVQSSASVTEE*

5'UTR

chr10:1082947..1082953 (+ strand) : 7 bp

CDS

chr10:1082954..1083133 (+ strand) : 180 bp

chr10:1083275..1083431 (+ strand) : 157 bp

chr10:1083704..1083811 (+ strand) : 108 bp

chr10:1083978..1084105 (+ strand) : 128 bp

chr10:1084205..1084333 (+ strand) : 129 bp

chr10:1084420..1084487 (+ strand) : 68 bp

chr10:1084567..1084804 (+ strand) : 238 bp

3'UTR

chr10:1084805..1084984 (+ strand) : 180 bp

FASTA

>Os10t0116800-01 class=Sequence position=chr10:1082947..1084984 (+ strand)
ATCAGCCATG GCTGTTGCAC TCGCGCTCTT GGCTGCCATG TCGGCGCTCT CGTCGTGCAC AAGTCCGGCC ACCGCAGAGC
TCACACGGCA CGAGCACCCG GTGGCCGCCG GCGCGCCGCT GCGCCTCCTC GTCGTCGGCG ACTGGGGCCG GAAGGGCGGC
TACAACCAGA CAAGAGTTGC AGAACAGGTG ATTTTGCTTT CTTTGCATCA AACATTCATT CAACAATTCA ATCAGAGAAT
GTTAATTTGT TGGCACCGAT CAAAAGAAGA AAAGAGAACA ACTGTATATC GATCAGAGAA TTTTGTTTGT TTGTTTGTGA
GGAGTTAGAT GGGGAAGGTT GCGGAGGAGA CGGAGATCGA CTTCGTCGTG TCAACCGGCG ACAACTTCTT GGAGAACGGC
CTCGCCGGCG TCGACGACAT GGCGTTCCAT GACTCCTTCA TGGATGTCTA CACGGCTCAG AGCTTGCACA AGCCATGGTA
CCTTGGTAAT CACCATCTAA ACCTAATTAA TTTCCATTTA ATACTATACT ATTAGATCAT ATGGATTTAT AAACTTACTA
TGTGTTTAGA ACTTTTTTTT TCTTTGACAT GGTGtgtttc tacaacttta gatggataaa acaagtcaga acaaaataaa
tgatatttac attctcctta ataaaggaga atggtcgaat gtcccgttga aaagtcaata tcattatgta tttaaaaagg
gatggagtaC TAACTAAAGG TTATCAATTG TTTTCAGTTC TTGGAAACCA TGACTACAGG GGAAATGTGC TAGCACAGAT
TGACCCAGCT CTGAGGAAGA TCGACAGCAG GTTCATCTGC ATGAGATCCT TCATTGTCAG TGCAGGTTGG TTAACACATC
AAAACCCACA ACAAACCTTG TTTCTTTTCT CAACATGCAG CAATTAAAAT CTGTGTTCAT AGCTAGAATC TTTGCAAATT
TACAATGGAA ATCTTTTCTG ATTAATACTA GAATCCACTG AACAAATTTA TAATGTCCTT TTTTCTGTAA GGAATTGTCG
ATTTCTTCTT TGTCGACACG ACCCCGTTTC AGCTCCAGTA CTGGACTGAT CCTGGAGAAG ATCACTATGA CTGGAGGGGA
GTCGCGCCTC GGGATGCGTA CATCGCCAAT CTCCTCGAGG TCAGTTCCTC TGATCAATAT CCACTGCAAA AACAATCCGC
TCGTTGCATC AGCAAAACTC TGTAATGAGA TGACTGTCTA TATGATTGTA TCACCTAGGA TGTTGATGCT GCAATGAAGA
AATCAACTGC AACATGGAAG ATAGCTGTAG GACATCATAC CATGAGGAGT GTGAGTGCCC ATGGAGACAC CCAGGAGCTC
CTTGAGCTTC TCCTTCCTGT CCTCAAGGTA ACACTGATAA AAAGTAGTAC TTTAATCTTC TACCAATTGG TTTCGCATAT
GAGCATTCGA TGAAATTTAC GATGATTTCA CAGGAAAACG GTGTCGATTT CTACATCAAT GGGCATGATC ACTGCCTGGA
GCACATCAGC AGCAGAAACA GGTGAGCACA CTAATACCTT GTGACACAAT AGAGGAAAGA AGGGTTCAAG AATCTTATGT
TCTTCCTCCT CTCTTTTCAG TCCAATTCAG TACTTCACTA GTGGAGGCGG ATCAAAGGCA TGGAGAGGCA TTTTTCAACA
AAACGAAGAC AAGCTCCAGT TCTTCTATGA TGGACAAGGG TTCCTGTCAC TTGAGCTCAG TGAGAACCGA GCTCGATTCG
CCTTCTACGA CGTTTTCGGT GAAGCTTTGT ACCACTGGAG CTTCAGCAAA GCTAATCTGC AGAAGGTTCA GTCCTCTGCT
AGTGTAACTG AAGAATGAGA GAAGCTGGAG CCTTCAGAAT ACATTCCCAC ACAGCTGAGT AGATGTCTAC CTGCATAATT
CTACTTGTAC AATTATGTCA CATTGTGCTC ATCAATACTG GATTTGCTAT GAATTAGCAA GTGTTTGATT CTACTAGAGA
AAGATCACAG AATGAAGCAG GTGTTTTTGC ACGAAGCC

Locus: Os10g0116800

Loading...

Locus: Os10g0116800

Loading...