Os10t0130000-00

Locus

Os10g0130000

Description

Similar to NPKL1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK361446 (DDBJ)

Protein Evidence

B8QUI8 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Expression Databases

TENOR (Os10t0130000-00)

Transcript

2256 bp

>Os10t0130000-00 Similar to NPKL1.
ATGCCAGCCTCACGCAATAAATACCCTCCTCGGCACGAGCAGCAGCATCCGCAACAAATT
CACAACCCTAATCCGGAAACATCAAGAACTCAACCCAATTCGCCTCCAATTAATTCCCCA
ATGGCCGCGGCGATCATCGGCGTCGGCGGCGGCGGATGGACGCGCCTCCGCAGCATCGGG
CACGGCGCGTCCGGCGCCACAGTGTCTCTCGCGGCGGACGACGCCTCCGGCGAGCTCTTC
GTCGTGAAGTCGGCCGGTGATGCGGTCGCCGCCACGGCGAGGCAGCAGCTCCGGCGAGAG
TGGAGCGTCATGTCCGGGCTCTCCTCGCCGCACGTGCTCAGGTGCCTTGGCTTTGTCCAG
gccgccgccggcgccggcggcgagcaccagctgctcctcgagtacgcgcccggcggatcg
ctcgccgacgtggtggcgagaaacggggatcgcctcgacgagagcgccttcagggcgtac
gcggcggacgtgctcagggggcttgattacctccacgagaagctcgtcgtgcacggcgac
gtcaaggggagtaatgtgctcgtcggcgccgatggccgcgccaagctcgccgacttcggg
tgcgcgagggtggtgatgcccggtggttcgaagcagccggtgctcggcggcacgccggcg
ttcatggcgcccgaggtggcgcgcggcgaggagcAAGGCCCGGCTGCCGACGTGTGGGCG
CTGGGCTGCACCGTCATCGAGATGGCCACCGGCCGCGCCCCGTGGAGCGACATGGACGAC
GTGCTCGCCGCTCTCCGGATGATCGGGTACACGGACGCCGTGCCGGACCTGCCGCCATGG
CTGTCACCGGAGGCGAAGGACTTCTTGCGCCGGTGCATGCAACGGCGCGCCGGCGACCGG
CCCACGGCGGCGCAGCTGCTACAGCACCCGTTCGTCTCAAAGTCATGCGGTCTCAAGAAA
GAAGTCGTGAAGGCGACATGGGTGTCTCCGACGAGCGCGCTCGACGCAGCGGCGGCGTTG
TGGGAGTCCGAGACGTCGTCATCGACAGACGATGAGGAAGCTGACGACATGTCGAACAGC
CCCACCGGCCGGATCATAGCAATGGCATCCTCCGGCGGCCAGACATTGCCGGACTGGGAC
TCCGACGACCATGGCTGGATCGAAGTACTCGGCACCCTCTCGCCTCCGATTCCCCAATGG
CCGCGGCGATCATCGGCGGCGGCGGATGGACGCGCCTCCGCAGCGTTGGCCGGGGCGCTT
CCGGCGCCGTGGTGTCGCTGGCAGCGAACGACGTCTCCGGGGAGCTCTTCGTCATCAAGT
CGGCCGGCGAGGGCGCCGCGAGGCAGCAGCTCCGGCGAGAGTGGAGCGTCATGTCCGGGC
TGTCCTCGCCGCACGTGCTCAAGTGCCTTGGCTTTGTCCAGGCCTCCGGCGGCTGCGGCG
GCGGCGAGCACCAGCTGTTCCTGGAGTACGCgcccggcggatcgctcgccgacgtggtgg
cgagaaacgggggtcgcctcgacgagggcgccgtcaggacgtacgcggccgacgtgctta
gagggctcgactacctccacgggaagctcgtcgtgcacggcgacgtcaaggggagtaatg
tgctcgtcggcgccgatggccgcgccaagctcaccgacttcgggtgcgcgagggtggcaa
tgcccggtggttcgaagcagccggtgctcggcggcacgccggcgttcatggcgcccgagg
tggcgcgtggcgaggagcaagggctggccgccgacgtctgggcgctgggctgcaccgtca
tcgagatggccaccggccgcgccccgtggagcGACATGGACAACGTCCTCCCCGCGCTCC
ACAAGATCGGGTACACGGACGCCGTGCCGGACCTGCCACGGTGGCTGTCACCGGAGGCGA
AGGACTTCTTGCGCGGATGCCTGCAACGGCGCGCCGGCGACCGTCCCACGGCGGCGCAGC
TGCTACAGCACCCGTTCATCTCCAAGTCATGCGGTCTCAACAACAAGGAAACCGTCAAGG
CGACATGGGTGTCGCCGACGAGCGCGCTCGACGCGACATTATGGGAGTCCGAGTCGTCGT
CGACCGACGGCGAGGAAGTCGACGACATGTCGTCGAACAGCCCTACCGGCCGGATCAGAG
CAATGGCATGCTCCTGCCAGACATTGCCGGACTGGGACTCCGACGACCATGGCTGCAGCT
GGATCGAAGTCCTCGGCAGCGTCTCCATTAATGTAG

CDS

2256 bp

>Os10t0130000-00 Similar to NPKL1.
ATGCCAGCCTCACGCAATAAATACCCTCCTCGGCACGAGCAGCAGCATCCGCAACAAATT
CACAACCCTAATCCGGAAACATCAAGAACTCAACCCAATTCGCCTCCAATTAATTCCCCA
ATGGCCGCGGCGATCATCGGCGTCGGCGGCGGCGGATGGACGCGCCTCCGCAGCATCGGG
CACGGCGCGTCCGGCGCCACAGTGTCTCTCGCGGCGGACGACGCCTCCGGCGAGCTCTTC
GTCGTGAAGTCGGCCGGTGATGCGGTCGCCGCCACGGCGAGGCAGCAGCTCCGGCGAGAG
TGGAGCGTCATGTCCGGGCTCTCCTCGCCGCACGTGCTCAGGTGCCTTGGCTTTGTCCAG
gccgccgccggcgccggcggcgagcaccagctgctcctcgagtacgcgcccggcggatcg
ctcgccgacgtggtggcgagaaacggggatcgcctcgacgagagcgccttcagggcgtac
gcggcggacgtgctcagggggcttgattacctccacgagaagctcgtcgtgcacggcgac
gtcaaggggagtaatgtgctcgtcggcgccgatggccgcgccaagctcgccgacttcggg
tgcgcgagggtggtgatgcccggtggttcgaagcagccggtgctcggcggcacgccggcg
ttcatggcgcccgaggtggcgcgcggcgaggagcAAGGCCCGGCTGCCGACGTGTGGGCG
CTGGGCTGCACCGTCATCGAGATGGCCACCGGCCGCGCCCCGTGGAGCGACATGGACGAC
GTGCTCGCCGCTCTCCGGATGATCGGGTACACGGACGCCGTGCCGGACCTGCCGCCATGG
CTGTCACCGGAGGCGAAGGACTTCTTGCGCCGGTGCATGCAACGGCGCGCCGGCGACCGG
CCCACGGCGGCGCAGCTGCTACAGCACCCGTTCGTCTCAAAGTCATGCGGTCTCAAGAAA
GAAGTCGTGAAGGCGACATGGGTGTCTCCGACGAGCGCGCTCGACGCAGCGGCGGCGTTG
TGGGAGTCCGAGACGTCGTCATCGACAGACGATGAGGAAGCTGACGACATGTCGAACAGC
CCCACCGGCCGGATCATAGCAATGGCATCCTCCGGCGGCCAGACATTGCCGGACTGGGAC
TCCGACGACCATGGCTGGATCGAAGTACTCGGCACCCTCTCGCCTCCGATTCCCCAATGG
CCGCGGCGATCATCGGCGGCGGCGGATGGACGCGCCTCCGCAGCGTTGGCCGGGGCGCTT
CCGGCGCCGTGGTGTCGCTGGCAGCGAACGACGTCTCCGGGGAGCTCTTCGTCATCAAGT
CGGCCGGCGAGGGCGCCGCGAGGCAGCAGCTCCGGCGAGAGTGGAGCGTCATGTCCGGGC
TGTCCTCGCCGCACGTGCTCAAGTGCCTTGGCTTTGTCCAGGCCTCCGGCGGCTGCGGCG
GCGGCGAGCACCAGCTGTTCCTGGAGTACGCgcccggcggatcgctcgccgacgtggtgg
cgagaaacgggggtcgcctcgacgagggcgccgtcaggacgtacgcggccgacgtgctta
gagggctcgactacctccacgggaagctcgtcgtgcacggcgacgtcaaggggagtaatg
tgctcgtcggcgccgatggccgcgccaagctcaccgacttcgggtgcgcgagggtggcaa
tgcccggtggttcgaagcagccggtgctcggcggcacgccggcgttcatggcgcccgagg
tggcgcgtggcgaggagcaagggctggccgccgacgtctgggcgctgggctgcaccgtca
tcgagatggccaccggccgcgccccgtggagcGACATGGACAACGTCCTCCCCGCGCTCC
ACAAGATCGGGTACACGGACGCCGTGCCGGACCTGCCACGGTGGCTGTCACCGGAGGCGA
AGGACTTCTTGCGCGGATGCCTGCAACGGCGCGCCGGCGACCGTCCCACGGCGGCGCAGC
TGCTACAGCACCCGTTCATCTCCAAGTCATGCGGTCTCAACAACAAGGAAACCGTCAAGG
CGACATGGGTGTCGCCGACGAGCGCGCTCGACGCGACATTATGGGAGTCCGAGTCGTCGT
CGACCGACGGCGAGGAAGTCGACGACATGTCGTCGAACAGCCCTACCGGCCGGATCAGAG
CAATGGCATGCTCCTGCCAGACATTGCCGGACTGGGACTCCGACGACCATGGCTGCAGCT
GGATCGAAGTCCTCGGCAGCGTCTCCATTAATGTAG

Protein

752 aa

>Os10t0130000-00 Similar to NPKL1.
MPASRNKYPPRHEQQHPQQIHNPNPETSRTQPNSPPINSPMAAAIIGVGGGGWTRLRSIG
HGASGATVSLAADDASGELFVVKSAGDAVAATARQQLRREWSVMSGLSSPHVLRCLGFVQ
AAAGAGGEHQLLLEYAPGGSLADVVARNGDRLDESAFRAYAADVLRGLDYLHEKLVVHGD
VKGSNVLVGADGRAKLADFGCARVVMPGGSKQPVLGGTPAFMAPEVARGEEQGPAADVWA
LGCTVIEMATGRAPWSDMDDVLAALRMIGYTDAVPDLPPWLSPEAKDFLRRCMQRRAGDR
PTAAQLLQHPFVSKSCGLKKEVVKATWVSPTSALDAAAALWESETSSSTDDEEADDMSNS
PTGRIIAMASSGGQTLPDWDSDDHGWIEVLGTLSPPIPQWPRRSSAAADGRASAALAGAL
PAPWCRWQRTTSPGSSSSSSRPARAPRGSSSGESGASCPGCPRRTCSSALALSRPPAAAA
AASTSCSWSTRPADRSPTWWRETGVASTRAPSGRTRPTCLEGSTTSTGSSSCTATSRGVM
CSSAPMAAPSSPTSGARGWQCPVVRSSRCSAARRRSWRPRWRVARSKGWPPTSGRWAAPS
SRWPPAAPRGATWTTSSPRSTRSGTRTPCRTCHGGCHRRRRTSCADACNGAPATVPRRRS
CYSTRSSPSHAVSTTRKPSRRHGCRRRARSTRHYGSPSRRRPTARKSTTCRRTALPAGSE
QWHAPARHCRTGTPTTMAAAGSKSSAASPLM*

CDS

chr10:1833726..1834901 (- strand) : 1176 bp

chr10:1829318..1830397 (- strand) : 1080 bp

FASTA

>Os10t0130000-00 class=Sequence position=chr10:1829318..1834901 (- strand)
ATGCCAGCCT CACGCAATAA ATACCCTCCT CGGCACGAGC AGCAGCATCC GCAACAAATT CACAACCCTA ATCCGGAAAC
ATCAAGAACT CAACCCAATT CGCCTCCAAT TAATTCCCCA ATGGCCGCGG CGATCATCGG CGTCGGCGGC GGCGGATGGA
CGCGCCTCCG CAGCATCGGG CACGGCGCGT CCGGCGCCAC AGTGTCTCTC GCGGCGGACG ACGCCTCCGG CGAGCTCTTC
GTCGTGAAGT CGGCCGGTGA TGCGGTCGCC GCCACGGCGA GGCAGCAGCT CCGGCGAGAG TGGAGCGTCA TGTCCGGGCT
CTCCTCGCCG CACGTGCTCA GGTGCCTTGG CTTTGTCCAG gccgccgccg gcgccggcgg cgagcaccag ctgctcctcg
agtacgcgcc cggcggatcg ctcgccgacg tggtggcgag aaacggggat cgcctcgacg agagcgcctt cagggcgtac
gcggcggacg tgctcagggg gcttgattac ctccacgaga agctcgtcgt gcacggcgac gtcaagggga gtaatgtgct
cgtcggcgcc gatggccgcg ccaagctcgc cgacttcggg tgcgcgaggg tggtgatgcc cggtggttcg aagcagccgg
tgctcggcgg cacgccggcg ttcatggcgc ccgaggtggc gcgcggcgag gagcAAGGCC CGGCTGCCGA CGTGTGGGCG
CTGGGCTGCA CCGTCATCGA GATGGCCACC GGCCGCGCCC CGTGGAGCGA CATGGACGAC GTGCTCGCCG CTCTCCGGAT
GATCGGGTAC ACGGACGCCG TGCCGGACCT GCCGCCATGG CTGTCACCGG AGGCGAAGGA CTTCTTGCGC CGGTGCATGC
AACGGCGCGC CGGCGACCGG CCCACGGCGG CGCAGCTGCT ACAGCACCCG TTCGTCTCAA AGTCATGCGG TCTCAAGAAA
GAAGTCGTGA AGGCGACATG GGTGTCTCCG ACGAGCGCGC TCGACGCAGC GGCGGCGTTG TGGGAGTCCG AGACGTCGTC
ATCGACAGAC GATGAGGAAG CTGACGACAT GTCGAACAGC CCCACCGGCC GGATCATAGC AATGGCATCC TCCGGCGGCC
AGACATTGCC GGACTGGGAC TCCGACGACC ATGGCTGGAT CGAAGTACTC GGCACCGTCT CCATTAACAT AGCAAAAAAA
AAAACAGCAG CAGCAGAAGA TTACGAAGCT TCAGAGTCTC CGGCCAAGAG GGTGAGAGCA ATGGCGTGCT CGCCGTCGTC
GGTGCCGGAC TGGGACTCCG ACAACCATGG TTGGATCGAT GTCCTCAGCG CGTCACCGGC CGACGACAAT GGCGGTGAAG
GGAATGCGCC TGAAGAATTC GATGTAGTGG CAGCCGCCGA TCAGATTTTC GGCGAAGCTG TGGGTAGCAT TGTTGTAGGA
GTAGGTAGTG AACAATCTGT AGTTGTTGAG AACCAGGAGG ATGAGTTCAT CTCCTTGAGT TATTGCAGCG AGAGAATTTT
GCTTGTAGCT GTTCATGCTG CTGATAATAA TGCGGCCTCT CGAAAGGCCG GAATAAAAGA ATGTTCTCAT GATCCTCGTC
CCTCGATCCC CAGTCGATGT GCTCATAACC TTTTTCTCTC CCTAATCTTC ATACAGATCG ATAATTCGAA TGTAGTCCCC
TTCGCTCCGA AATATTGACT TGTTACTCGA TTAGAAGCCT CCTAGGACTA TTAATCTAGG CAGAGCAGAT CCCCTGTTCA
TAGTCATCAT AGAACTACGT GACGTCTAAT CAAGTACTAG CTTGGTATAT TTTTTTGACA GAGCAAGGGT AGTGAGCTTT
ATTGGCATGG AAGGTGTTGA TGTCGGAGGC CGGAACAGTG CCTCGCAGAG TCGCAGTCCA GCGTGGAGAG GTGAAGGATG
AGTTAGAACG AGTCCTGCTG CACTTGAGCG CGCCGCATGG TCCCTCAGCC TGGTCggggg tatagatggc catatggccc
gtggcccgtg gcccggccca aagcatggca cggcccgact gaggtcgtgc ccatgtcggc ccgacccgac agccgggcca
tgcttgggcc acaccttcag cacgttgggc cggcacagca tggcccggtc aaataaaaaa tatagagatg aaaaatagac
ttaaataatc gtataaggca aggcccaaga caagaggtat acaaaataga tttattttcc agccatttaa acacagccca
tagagttgag ggaccaaaca tagactttta tgtgaggagt atacaaaata gacttattct ccagccattt aaacacagta
cacagagttg agggaccaaa attagacatt ttctgtgagg aagcacgata gcccatcgtg ccttcgggcc ggcctggcac
ggctcgagta gtattgggcc gtgcctgggc cgtgtatgcc gcccgtgagc tggcacagta cagcctggtg catcggtcgg
gccgtgccgg cccgacaagc ctcggcccag gcacggccgg gcttgggccg tgccgtgccg ggtggcccac atgaccatct
atagttggGG GTGATACAGC GGCTGACCCT GAAGCCTATG ATGAGCAAAA TAGACTTGCA AAAGGGCGTG ATATTGTTCT
ATAGGCCTGA GTAGTACGTT GGCGTGTGCG TATATACCCC ATCTTTGTTT GTAGGGAAGC TGCTACTATT GTTTGTCAGC
TCAGGCGAGG TGAGGAAGGG GCGTGAGAGT GGGAGGAGGA GGAGGAAGGG GAGGGGGAAG GGGTTTTGTT TGGCTCTGGC
CCAACGGTTC AGGAGAAGGA AGGGATATAG GAATTGGTGG TTGAGGCCAG GCTGAGCGTT TTGGAGATGA TCTTGTACTT
CTTGACGATC TCGACAAGCC AGTCGATGCC TATACATGTT GGTCATTTAT GCCCTATGCC CATTCGAAGG TGTCACTATA
TATCGCATGC CCCCTCCGAA GCCCATTGTT GTTGTTGTGC TCGTCATCAT GGTCCTTGTC ATCGTTGCCA GACCCCAGCG
GTACTGCGCC ACCAAGGTCA CCAAGATGGG GGTGGCCAGA TCCGGATGCC ATGCCCATAT AGCTACACAC CTCCGAAGCC
CATCTTTGTG CCCGTCATAC TACTAGGCCA CCGAGATACA AGCGGGCACA TCTCACTACC ATGTCCAGAG GCTCACTAGC
ACTCGGGGCT TAGGGGATGG TGGCTTGCAT TGGATCTAGC CACCTATATG ATGTTAAGGA GAGCATATTC AGTGTCCTCC
GATATCAGGG AGGTTGGATC TGGCATCTCT AAGGTGGTGG CCGGTGCTTG GGGTTAGGGG GTGAAGATGG TGGTGGCGGC
TCGTTTTCGG GGCCAGAGGC GATGATGGCT GGAGTTCGAG GACGGATCAA GGAGGCAACA ACTGGCTCGA GTCCTTGGGA
GTTAGAGTAT ATATGTTAGA AAGAGATAAA TTAAAGAGAG GGGATAGCAA GCGAGAAATA AAGAGGAGAC GATGACGTCA
ACACGTGGTA GGAGCGTATG ACGTAGTATG TCCTCCATGA TAGGTTAAAA GAAAGAGCCA TAATAGATTA TAACTCATTT
TTAGCGATTG TTATTTATAA ATCGCACTTA TGTCTTTATT ATGTCTGGTG GGCCATATGA TTGGACCTGC CATATATGTG
GGGTCATCAT ATATGATCTT TGACGGTTTA TAATTTTGAC TCATCATAGA TGACATCATA TACAGGTAGT TCCCTTTTGT
CATATCTCGA ATGGTATTTT TTTTTTACAT GTTAGAGCTC ATGTTATCTG AGACGGATCA CTTTGACCGG TTATCTTGGT
TCTGTAGTAG TGAATGGAAT ATAAAGTAGC ACAAACATAC CTTTAACCGT CCCTTATTGC ATGTTTCAGG GACTTTACTG
GATGATGATT AATCAACCAT TTAATCACTT CTAAAGATAT GAGGCACATT TTGCACCATA GATCTTAATT TCTTAGCTCG
ATGACCACAT TGACTAGTCT TGGACCCACA AAATTTCCAT ATATAACGAC GAGAGAGAGA GTAGTTCTTA ATAATTTATT
TTAACATTTC ATTTTTTTAC AATGGATCAT GCAAAAACGC AAAATTTGCT CACAAGCGTA CTATTTCTCA CTCCACGTTT
TCCACCCCAT GGTTTACACA GGGAAAAAAA TAGAAAGAAA TACACTAAAC ACGTCTATCC TTTTGTTTTT ACCTCTCGTT
TCCTTCTTAA TCCACATGGA TTAAAAATAA AAAAGAGGAT AATAAACACA CCTTTCCTTA ACAGAGCACA CTGGTAAATT
TCCAGCTATA GCAATAATCT TGTCGGCCCC CTCGCTTCTC TAGTGCATTT CACAGTTCAC ACTGCAATGC GCGGCGCTAC
GGGTCCCACA TGCCAGCCTC ACGCATTAAA TAAATACTCT CCTCGATCGA CTCGAGCAGC AGCATTCGCA ACCCTAATCC
GGAAACACCA ACAACTCAAC CCAGCTCTCG CCTCCGATTC CCCAATGGCC GCGGCGATCA TCGGCGGCGG CGGATGGACG
CGCCTCCGCA GCGTTGGCCG GGGCGCTTCC GGCGCCGTGG TGTCGCTGGC AGCGAACGAC GTCTCCGGGG AGCTCTTCGT
CATCAAGTCG GCCGGCGAGG GCGCCGCGAG GCAGCAGCTC CGGCGAGAGT GGAGCGTCAT GTCCGGGCTG TCCTCGCCGC
ACGTGCTCAA GTGCCTTGGC TTTGTCCAGG CCTCCGGCGG CTGCGGCGGC GGCGAGCACC AGCTGTTCCT GGAGTACGCg
cccggcggat cgctcgccga cgtggtggcg agaaacgggg gtcgcctcga cgagggcgcc gtcaggacgt acgcggccga
cgtgcttaga gggctcgact acctccacgg gaagctcgtc gtgcacggcg acgtcaaggg gagtaatgtg ctcgtcggcg
ccgatggccg cgccaagctc accgacttcg ggtgcgcgag ggtggcaatg cccggtggtt cgaagcagcc ggtgctcggc
ggcacgccgg cgttcatggc gcccgaggtg gcgcgtggcg aggagcaagg gctggccgcc gacgtctggg cgctgggctg
caccgtcatc gagatggcca ccggccgcgc cccgtggagc GACATGGACA ACGTCCTCCC CGCGCTCCAC AAGATCGGGT
ACACGGACGC CGTGCCGGAC CTGCCACGGT GGCTGTCACC GGAGGCGAAG GACTTCTTGC GCGGATGCCT GCAACGGCGC
GCCGGCGACC GTCCCACGGC GGCGCAGCTG CTACAGCACC CGTTCATCTC CAAGTCATGC GGTCTCAACA ACAAGGAAAC
CGTCAAGGCG ACATGGGTGT CGCCGACGAG CGCGCTCGAC GCGACATTAT GGGAGTCCGA GTCGTCGTCG ACCGACGGCG
AGGAAGTCGA CGACATGTCG TCGAACAGCC CTACCGGCCG GATCAGAGCA ATGGCATGCT CCTGCCAGAC ATTGCCGGAC
TGGGACTCCG ACGACCATGG CTGCAGCTGG ATCGAAGTCC TCGGCAGCGT CTCCATTAAT GTAG