Os10t0147400-01

Locus

Os10g0147400

Description

Similar to Auxin influx carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX4, OsRAU4, OsAUX4, LAX4, RAU4, AUX4

Oryzabase Gene Name Synonym(s)

like aux1-4, related to AUX1-4, auxin transporter 4

Transcript Evidence

AK102295 (DDBJ, Best hit)

AK102729 (DDBJ, Best hit)

Protein Evidence

B6TFK4 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Amino acid transporter, transmembrane (IPR013057)

Full-length cDNA

J033089L08 (Online Clone Ordering)

J033105O21 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0147400-01)

RiceXPro (AK102295)

Others

Oryzabase (11919)

KEGG (Os10t0147400-01)

Transcript

2105 bp

>Os10t0147400-01 Similar to Auxin influx carrier protein.
AACACACCACACACACCCACACTGGCAGCAGCTCATACACATAGCTAGCTCAGCTGAGAC
ACACACACACACAGTGAGTAGTTCAGCTCAAAGCTAGCATCAGCAGCAGAGCTAATTAAC
AAACATGGCGTCCGGGAGCAGCGGCGGCGGCTACGCGGACGAGAAGGGGCCGGGGGCGGC
GACGATGCAGGCGCTGGGGCTGCAGCAGCAGCACGGCGGCGGCGGAGAGGTGGAAGAGGA
GTCGTCGGAGATGGGGGAGAAGACGGCGGCGAGGACGCGGCTGTCGGGGCTGCTGTGGCA
CGGGGGGTCGGCGTACGACGCGTGGTTCAGCTGCGCGTCGAACCAGGTGGCGCAGGTGCT
GCTGACGCTGCCCTACTCGTTCGCGCAGCTGGGCATGGCCAGCGGCCTCCTCTTCCAGCT
CTTCTACGGCCTCCTCGGCAGCTGGACCGCCTACCTCATCAGCATCCTCTACCTCGAGTA
CCGCACCCGCAAGGAGCGCGACAAGGTCGACTTCCGCAACCACGTCATCCAGTGGTTTGA
GGTGCTGGATGGGCTACTGGGGAGGCACTGGAGGAATGTGGGACTGGCCTTCAACTGCAC
GTTTTTGCTGTTCGGGTCGGTGATCCAACTGATCGGGTGTGCCAGCAACATCTACTACAT
CAACGACCATCTGGACAAGCGGACATGGACGTACATCTTCGGCGCCTGCTGCGCCACCAC
CGTCTTCATCCCGTCATTCCACAACTACCGCATTTGGTCCTTCCTCGGCCTCCTCATGAC
CACCTACACCGCCTGGTACATCGCCGTCGCCTCCCTCATCCACGGACAGGTGGAGGGTGT
GGCGCACTCTGGGCCCACAAGCATCGTGCTCTACTTCACGGGGGCCACCAACATCCTCTA
CACCTTCGGGGGCCACGCTGTCACCGTGGAGATAATGCACGCGATGTGGCGGCCGCAGAA
GTTCAAGGCGATCTACCTGCTGGCGACGGTGTACGTGCTGACGCTGACGCTGCCGTCGGC
GTCGGCGGCGTACTGGGCGTTCGGGGACGCGCTGCTGACGCACTCGAACGCGCTGGCGCT
GCTGCCGCGGACGCCGTGGCGCGACGCCGCGGTGGTGCTCATGCTCATCCACCAGTTCAT
CACCTTCGGCTTCGCCTGCACCCCGCTCTACTTCGTCTGGGAGAAGCTCGTCGGCCTCCA
CGGCTGCCCCTCCCTCTGCAAGCGCGCCGCCGCCCGCCTCCCCGTCGTCCTCCCCATCTG
GTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTCGGCTCCCTCCT
CGTCAGCTTCACCGTCTACATCATCCCCTCCCTCGCCTACATGGTCACCTTCCGCTCCCC
GCAATCCCGCCAGAACGCGGTGGAGCGGCCGCCGAGGTTCGCCGGAGGATGGACGGGGGC
GTACGTGATAAACTCGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGCTTCGGCTTCGGCGG
GTGGGCGAGCATCACCAACTTCGTCCACCAGGTCGACACCTTCGGCCTCTTCGCCAAGTG
CTACCAGTGCCCGCCTCACCCCGCCGCCGCCGCCCTCTCGCCGCCGGGTGCCATCGCTCC
GGCGCCGGCCTCGATGCTGCCGCCGTTCAACTCCACCGCCGCCGGCATCTTTGCCGCTCC
GGTGCCGTCTCCTGCTCCGGCTCCGGCACCGATGCATTTCGTCCTTGGTCACCACCACCA
TCACCGGCACCACCGCCACGGCCTCTAGCTAATTAATCGAGATCAATCAAGATCATGATT
ATCAGAGGTTGGGTTTGCATTATTGCACTAGTTTTTAGCGAGCTACTAGCTAGTTGATCA
TCACTGCAAGATTGTTAATTAGCGCTAGTAATTAGTAAAAGTAAGCCTCTTTTCCTAATC
CTATTGTATGCTTTGCTTCTTTCTTCTTCTTCTGGTTACTGAGAGAGAGTGAGAGTGAGA
ATGTTTGGTGGTGGGGTATGCATGTCAGAGACACGTTTCAAGTCTCTCGTCTTGTAATGT
GTCCTTTTTGTGTGGAGCTGCTTTTGAGAAAGAAAGAAGAGAGATCAAATTTAAAAAAAA
AATGG

CDS

1644 bp

>Os10t0147400-01 Similar to Auxin influx carrier protein.
ATGGCGTCCGGGAGCAGCGGCGGCGGCTACGCGGACGAGAAGGGGCCGGGGGCGGCGACG
ATGCAGGCGCTGGGGCTGCAGCAGCAGCACGGCGGCGGCGGAGAGGTGGAAGAGGAGTCG
TCGGAGATGGGGGAGAAGACGGCGGCGAGGACGCGGCTGTCGGGGCTGCTGTGGCACGGG
GGGTCGGCGTACGACGCGTGGTTCAGCTGCGCGTCGAACCAGGTGGCGCAGGTGCTGCTG
ACGCTGCCCTACTCGTTCGCGCAGCTGGGCATGGCCAGCGGCCTCCTCTTCCAGCTCTTC
TACGGCCTCCTCGGCAGCTGGACCGCCTACCTCATCAGCATCCTCTACCTCGAGTACCGC
ACCCGCAAGGAGCGCGACAAGGTCGACTTCCGCAACCACGTCATCCAGTGGTTTGAGGTG
CTGGATGGGCTACTGGGGAGGCACTGGAGGAATGTGGGACTGGCCTTCAACTGCACGTTT
TTGCTGTTCGGGTCGGTGATCCAACTGATCGGGTGTGCCAGCAACATCTACTACATCAAC
GACCATCTGGACAAGCGGACATGGACGTACATCTTCGGCGCCTGCTGCGCCACCACCGTC
TTCATCCCGTCATTCCACAACTACCGCATTTGGTCCTTCCTCGGCCTCCTCATGACCACC
TACACCGCCTGGTACATCGCCGTCGCCTCCCTCATCCACGGACAGGTGGAGGGTGTGGCG
CACTCTGGGCCCACAAGCATCGTGCTCTACTTCACGGGGGCCACCAACATCCTCTACACC
TTCGGGGGCCACGCTGTCACCGTGGAGATAATGCACGCGATGTGGCGGCCGCAGAAGTTC
AAGGCGATCTACCTGCTGGCGACGGTGTACGTGCTGACGCTGACGCTGCCGTCGGCGTCG
GCGGCGTACTGGGCGTTCGGGGACGCGCTGCTGACGCACTCGAACGCGCTGGCGCTGCTG
CCGCGGACGCCGTGGCGCGACGCCGCGGTGGTGCTCATGCTCATCCACCAGTTCATCACC
TTCGGCTTCGCCTGCACCCCGCTCTACTTCGTCTGGGAGAAGCTCGTCGGCCTCCACGGC
TGCCCCTCCCTCTGCAAGCGCGCCGCCGCCCGCCTCCCCGTCGTCCTCCCCATCTGGTTC
CTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTCGGCTCCCTCCTCGTC
AGCTTCACCGTCTACATCATCCCCTCCCTCGCCTACATGGTCACCTTCCGCTCCCCGCAA
TCCCGCCAGAACGCGGTGGAGCGGCCGCCGAGGTTCGCCGGAGGATGGACGGGGGCGTAC
GTGATAAACTCGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGCTTCGGCTTCGGCGGGTGG
GCGAGCATCACCAACTTCGTCCACCAGGTCGACACCTTCGGCCTCTTCGCCAAGTGCTAC
CAGTGCCCGCCTCACCCCGCCGCCGCCGCCCTCTCGCCGCCGGGTGCCATCGCTCCGGCG
CCGGCCTCGATGCTGCCGCCGTTCAACTCCACCGCCGCCGGCATCTTTGCCGCTCCGGTG
CCGTCTCCTGCTCCGGCTCCGGCACCGATGCATTTCGTCCTTGGTCACCACCACCATCAC
CGGCACCACCGCCACGGCCTCTAG

Protein

548 aa

>Os10t0147400-01 Similar to Auxin influx carrier protein.
MASGSSGGGYADEKGPGAATMQALGLQQQHGGGGEVEEESSEMGEKTAARTRLSGLLWHG
GSAYDAWFSCASNQVAQVLLTLPYSFAQLGMASGLLFQLFYGLLGSWTAYLISILYLEYR
TRKERDKVDFRNHVIQWFEVLDGLLGRHWRNVGLAFNCTFLLFGSVIQLIGCASNIYYIN
DHLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLLMTTYTAWYIAVASLIHGQVEGVA
HSGPTSIVLYFTGATNILYTFGGHAVTVEIMHAMWRPQKFKAIYLLATVYVLTLTLPSAS
AAYWAFGDALLTHSNALALLPRTPWRDAAVVLMLIHQFITFGFACTPLYFVWEKLVGLHG
CPSLCKRAAARLPVVLPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPSLAYMVTFRSPQ
SRQNAVERPPRFAGGWTGAYVINSFVVAWVLVVGFGFGGWASITNFVHQVDTFGLFAKCY
QCPPHPAAAALSPPGAIAPAPASMLPPFNSTAAGIFAAPVPSPAPAPAPMHFVLGHHHHH
RHHRHGL*

5'UTR

chr10:2855686..2855809 (- strand) : 124 bp

CDS

chr10:2855278..2855685 (- strand) : 408 bp

chr10:2854773..2855069 (- strand) : 297 bp

chr10:2854381..2854478 (- strand) : 98 bp

chr10:2852155..2852620 (- strand) : 466 bp

chr10:2849957..2850331 (- strand) : 375 bp

3'UTR

chr10:2849620..2849956 (- strand) : 337 bp

FASTA

>Os10t0147400-01 class=Sequence position=chr10:2849620..2855809 (- strand)
AACACACCAC ACACACCCAC ACTGGCAGCA GCTCATACAC ATAGCTAGCT CAGCTGAGAC ACACACACAC ACAGTGAGTA
GTTCAGCTCA AAGCTAGCAT CAGCAGCAGA GCTAATTAAC AAACATGGCG TCCGGGAGCA GCGGCGGCGG CTACGCGGAC
GAGAAGGGGC CGGGGGCGGC GACGATGCAG GCGCTGGGGC TGCAGCAGCA GCACGGCGGC GGCGGAGAGG TGGAAGAGGA
GTCGTCGGAG ATGGGGGAGA AGACGGCGGC GAGGACGCGG CTGTCGGGGC TGCTGTGGCA CGGGGGGTCG GCGTACGACG
CGTGGTTCAG CTGCGCGTCG AACCAGGTGG CGCAGGTGCT GCTGACGCTG CCCTACTCGT TCGCGCAGCT GGGCATGGCC
AGCGGCCTCC TCTTCCAGCT CTTCTACGGC CTCCTCGGCA GCTGGACCGC CTACCTCATC AGCATCCTCT ACCTCGAGTA
CCGCACCCGC AAGGAGCGCG ACAAGGTCGA CTTCCGCAAC CACGTCATCC AGGTACCTAC TTACCTTCTC AAGGACTATA
AAATCGATCT CTCACATATA TAAATCAATA TGTGATATGA TGATACATGt ctctcttttt ttttatcttc ttaaagtatg
tttatggctg gctttatata gcctactatt atacctgctc taatATCGTT AACGATATAT AAATCAGTAC GTGATATGGT
GATACATGTT TTTGTACCAG TGGTTTGAGG TGCTGGATGG GCTACTGGGG AGGCACTGGA GGAATGTGGG ACTGGCCTTC
AACTGCACGT TTTTGCTGTT CGGGTCGGTG ATCCAACTGA TCGGGTGTGC CAGCAACATC TACTACATCA ACGACCATCT
GGACAAGCGG ACATGGACGT ACATCTTCGG CGCCTGCTGC GCCACCACCG TCTTCATCCC GTCATTCCAC AACTACCGCA
TTTGGTCCTT CCTCGGCCTC CTCATGACCA CCTACACCGC CTGGTACATC GCCGTCGCCT CCCTCATCCA CGGACAGGTA
CATATATATC TTACATAATA TTCATagcag ttttatagtt cttgaggagg tatcatgatg taccaaaaat ttaatataaa
atttggtacc tcatagtatt taggtaccaa aatgtatcaa atttataata taaaaaatag tacctcacga tacatcttca
agaactgtaa aattactcat CTTTTTTTAA TATAAGATCA AAGTCCCAAA CGTCACTTAT TTATGATAAC AAAATGATAG
TAATAGTGAT AGATAGTAAT TGTAATAGTG CATATATTGG GAATAATGCA GGTGGAGGGT GTGGCGCACT CTGGGCCCAC
AAGCATCGTG CTCTACTTCA CGGGGGCCAC CAACATCCTC TACACCTTCG GGGGCCACGC TGTCACCGTG TAAGCCGACC
ATCCTCTCTC TTGATTAGCT ATGGCTCGAT TAACCATTTG ATTGGTCATT AGTGCCTACT TAATTTTACT AAGTTTAGTT
TAGTTTAATT ACTCTAAAGT ACGAACGATT AGTACTGTAT CCACTTATAG CTGGCTTGCT GCCTGCCTAT TGTTAGTTAG
TTTACTTCTT TCCACTAATT AAGCTAGCTT AGCAGTAGTG TAACGGCTCA CTGCTAATGG AGCGTGAGTG CGCACCATGC
GAGGCATAAT GGCATGCATG GTCACGTGCC ATGCACGCAT GGCTTGAAGT ACTTACTGAC ATGTGGTCCC ATTAAACTTA
GGGACCACCA CTTGCACATA TAGGAACACA CGGGGTACCA CGTGATGAGA CGTGGATGTG GTTCCTCCTA ACATCCAAGT
ACACGTGTCC CGTTCATCTG TCCATGGAGG AGAAAATTGT AATATTGGGA CTGTAAACAT GAGGGCTTCG CTGTTTTAAC
ACTTCGAGTG GATGATAAAT GGGTCCATCT GTGTCTATAA AATATGGGTC CAGTGTCATT ATAACAAAAG TTAATGTTTG
CAGTGTTATA ATTGCAAATC CCCTCTGTTG AGCCAGTGCT ACCGTCGAGT CTAAGCAACC GTCGAAAAAA CTCGTAATAT
TAGCCATGGA ATGTATTTCT GTAGTTGTTT TACGAAATAT AGCTCATATC AATTTGGCAG TTGGCTATAA TATGCTGTTG
GTTTCGTCTA AGTTGATTAA GAGGGTGATA TATATGCTAG CAAATGAAGA ATGAACATCG ATCACATCTC GTTGGTGACT
CATGTATTTG TGGTCTAACC AGTCATTTTT GCCATGTTTA ATGGATCAAG CTAGTCTTAT AGCAATGTAA TGCCAAATGC
CAACACAAGC TAACTGGGCC CTTTGGTGTA AGCTCAGTCT ATAGCAGCTA GCATGCATcc atcatctcta gctactttgt
actccctccg tcccacaata taagagattt taagtttttg cttttaacgt ttgaccactc gtcttattta aatttttttt
gcaaatataa aaaacgaaaa gttatgctta aagtattgta gataataaag aaagtcaaaa ataaaataat taataatttt
aaaaaaattt aaataagacg agtggtcaaa cgttacaaac aaaaactcaa aattccttaa tattatggga cggagggagt
aTAGTTTGTG TCTTTATGTA CCAAACCAAG ACAAGACAAG ACCACACTGT ATACATGCTA CTACAGGAAA ATCACTTTGG
TACAGGTTAG AAAACCAATA TTTAACTTCG ATCGGTCACC TATAACTAAA AAAGATGTTA TGAACCTAGA ACAAACACCT
ATAAACTCTT ATAGGTGCCA TATTTTAAAC CGTCCGGTCA CACGTGGCAT GACATGCGCA ATGCCCACCA ACATCTGGGC
CCTGCATCGT CGTTTCTCTT GCACGAATCT GAAAGCACAC ACATGtactc cctccgtttt agattataag ttattttgat
tttggtcgaa atcaaactgc tttaagtttg actaaatttg taagaaaaaa ataatatttt taaccaaaat aaacatttaa
ttatagattt gattgaactg atttggtgtt gtaaatatta ctacatttat atctataaaa cttgggagta gattgatttt
aaccaaagtc aaaataactt atagtaGTAG TAATTAAGAA AGTAATTAAG GGATGAAATG CAAATGCAGG GAGATAATGC
ACGCGATGTG GCGGCCGCAG AAGTTCAAGG CGATCTACCT GCTGGCGACG GTGTACGTGC TGACGCTGAC GCTGCCGTCG
GCGTCGGCGG CGTACTGGGC GTTCGGGGAC GCGCTGCTGA CGCACTCGAA CGCGCTGGCG CTGCTGCCGC GGACGCCGTG
GCGCGACGCC GCGGTGGTGC TCATGCTCAT CCACCAGTTC ATCACCTTCG GCTTCGCCTG CACCCCGCTC TACTTCGTCT
GGGAGAAGCT CGTCGGCCTC CACGGCTGCC CCTCCCTCTG CAAGCGCGCC GCCGCCCGCC TCCCCGTCGT CCTCCCCATC
TGGTTCCTCG CCATCATCTT CCCCTTCTTC GGCCCCATCA ACTCCGCCGT CGGCTCCCTC CTCGTCAGCT TCACCGTCTA
CATCATCCCC TCCCTCGCCT ACATGGTCAC CTTCCGCTCC CCGCAATCCC GCCAGGTACC TTCTTACTTT TCTTCTTACT
CCATCCGTTT CAGGTTATAA GACGTTTTAA Ctttgttcaa acttaaattg ttttaagttt gactaagttt gtagaaaaaa
gtagtaatat ttttaacctc aagacaaatt tattatgaaa atatattcaa ttattgattt gatgaaacta tatttagtat
tataaatatt actatatttg tctataaacg tagtcaaatt tgaaacagtt tgactttgaG CAAAACCAAA ACATTTTATA
ACCTAACACG GAAGGAGTAC TAATTTTCTT TATCTTTCTA ATTCTCATCA TCAAAATGCA TTTTACATAT ATACATGCTT
GAATTTATTT GTCTTTGAGT GCCTACATTG GGGGTCCATT GCAACCATAT TTGCTGAGGC TTTAGGTAGA GATGATATAG
TTTCAGTGCT GTTCCTATGT ATACATAGTT GCCAAATGCT AGCTATCTAG ATACAGAAGC AAATGTTTGG TGATTGATGG
AACAGCTGGT TGTTGCAATG CAGCCTAGAC AGCATGAGCC CACCATGCTT CCCCATCACA CCTTGCTTGC TTCTTCTAGT
GCTTACTGAT AATTAGAACA GATCAATTAA TTAATTAATT GTTTGTCTTA ATTAATCAAA GCTAGCGCTA GCCATTAACA
AGACTAGCTA GTTGGCGTCT ATTTGATTGA TCTGCTGCTG GGACGTGGCA AATTCCAATG AACTCAACGT AACACTGGTA
ATTAAACACT ATTATTATTG TTTCTGCTGC TGCTGAGTGT TGCAAGTGTG TCATTCTCGG TGAAGAAGAG ACTGAATGCA
AGACAAATCT GAGCAGCGAC AGCATGCAAT TCCTTTGAGC TGAGCTAGAA ACCAGAGCAA GTGGCGATAT GATATGATAT
GATAAAAGAA AAGCTATATG TACCATAAAG CTACTGAAAG TGGTGTAGAG ATTAATCAGG ACGCTTGCTG CTGCTGCTGT
GCTGCATGCT TGCCTGCTGC AATGTTTTTG TACCATCTGC TGTCCGGGAG CCATTGGCAC CGAGCAGACA GACTGCATTG
CAATATTGCA TTGTATTTGC ATTAGAGAGA GAGCTAGGTC GACACCCATG ATACCATGTC TAGAAAGCAA CAAAAATAAA
GCTTTCAGCA ACAGCATCAT CACAGTATAC TAGTAGCAGT AGAATACCAT CATTCACCTA ATGACCTACT TGTGACATCA
TCCCAATGCA AGCTTAACTT ATCTTTGCAT AATCTTTAAT TTCTTCCTGA TCTGCATCCA TATACTGTTC TGTTTGATTC
TGAAACAGTA CATACAATAC ATACAGTTGC ATGTTCTGTT TCGTATAATT CGGTAACAGT AGTATAATAA CTCAAACATA
TATAATTAAG TAAAGGTGCA ATATTATTAG ACTTTTGCAT AATCTTTTCT TTCTGATCCC TGCATTCATA TATACTGCTC
TCTGTTGGAT TCTTGAACAG TAATCTAACT GAAAATTATA Attagagcaa gtttaatagt atagctaact gctgactcta
aattatctat agttaactta atagccaatt aatagccaat tcatacaata gttacctata aacatatact acataatcaa
tatttggtcc cacctgtcat acacatatgc attttacagt ctgtgctgta gctggcttac aaatctgtaa cccgctactc
ttacctctac tcttttatct tcttgaaata tgcttatagc tgacttatag tcagctattg tacctgctAT CACGAGATGA
TAGTAATTAA TAACTGATTG GATTGGATTG GATTGCAGAA CGCGGTGGAG CGGCCGCCGA GGTTCGCCGG AGGATGGACG
GGGGCGTACG TGATAAACTC GTTCGTGGTG GCGTGGGTGC TGGTGGTCGG CTTCGGCTTC GGCGGGTGGG CGAGCATCAC
CAACTTCGTC CACCAGGTCG ACACCTTCGG CCTCTTCGCC AAGTGCTACC AGTGCCCGCC TCACCCCGCC GCCGCCGCCC
TCTCGCCGCC GGGTGCCATC GCTCCGGCGC CGGCCTCGAT GCTGCCGCCG TTCAACTCCA CCGCCGCCGG CATCTTTGCC
GCTCCGGTGC CGTCTCCTGC TCCGGCTCCG GCACCGATGC ATTTCGTCCT TGGTCACCAC CACCATCACC GGCACCACCG
CCACGGCCTC TAGCTAATTA ATCGAGATCA ATCAAGATCA TGATTATCAG AGGTTGGGTT TGCATTATTG CACTAGTTTT
TAGCGAGCTA CTAGCTAGTT GATCATCACT GCAAGATTGT TAATTAGCGC TAGTAATTAG TAAAAGTAAG CCTCTTTTCC
TAATCCTATT GTATGCTTTG CTTCTTTCTT CTTCTTCTGG TTACTGAGAG AGAGTGAGAG TGAGAATGTT TGGTGGTGGG
GTATGCATGT CAGAGACACG TTTCAAGTCT CTCGTCTTGT AATGTGTCCT TTTTGTGTGG AGCTGCTTTT GAGAAAGAAA
GAAGAGAGAT CAAATTTAAA AAAAAAATGG 

Locus: Os10g0147400

Loading...

Locus: Os10g0147400

Loading...