Os10t0147400-03

Locus

Os10g0147400

Description

Similar to Auxin transporter-like protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX4, OsRAU4, OsAUX4, LAX4, RAU4, AUX4

Oryzabase Gene Name Synonym(s)

like aux1-4, related to AUX1-4, auxin transporter 4

Transcript Evidence

AK063919 (DDBJ, Best hit)

Protein Evidence

NP_001105117.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

001-123-B07 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0147400-03)

RiceXPro (AK063919)

Others

Oryzabase (11919)

KEGG (Os10t0147400-03)

Transcript

1402 bp

>Os10t0147400-03 Similar to Auxin transporter-like protein 3.
ATGTCTAGAAAGCAACAAAAATAAAGCTTTCAGCAACAGCATCATCACAGTATACTAGTA
GCAGTAGAATACCATCATTCACCTAATGACCTACTTGTGACATCATCCCAATGCAAGCTT
AACTTATCTTTGCATAATCTTTAATTTCTTCCTGATCTGCATCCATATACTGTTCTGTTT
GATTCTGAAACAGTACATACAATACATACAGTTGCATGTTCTGTTTCGTATAATTCGGTA
ACAGTAGTATAATAACTCAAACATATATAATTAAGTAAAGGTGCAATATTATTAGACTTT
TGCATAATCTTTTCTTTCTGATCCCTGCATTCATATATACTGCTCTCTGTTGGATTCTTG
AACAGTAATCTAACTGAAAATTATAAttagagcaagtttaatagtatagctaactgctga
ctctaaattatctatagttaacttaatagccaattaatagccaattcatacaatagttac
ctataaacatatactacataatcaatatttggtcccacctgtcatacacatatgcatttt
acagtctgtgctgtagctggcttacaaatctgtaacccgctactcttacctctactcttt
tatcttcttgaaatatgcttatagctgacttatagtcagctattgtacctgctATCACGA
GATGATAGTAATTAATAACTGATTGGATTGGATTGGATTGCAGAACGCGGTGGAGCGGCC
GCCGAGGTTCGCCGGAGGATGGACGGGGGCGTACGTGATAAACTCGTTCGTGGTGGCGTG
GGTGCTGGTGGTCGGCTTCGGCTTCGGCGGGTGGGCGAGCATCACCAACTTCGTCCACCA
GGTCGACACCTTCGGCCTCTTCGCCAAGTGCTACCAGTGCCCGCCTCACCCCGCCGCCGC
CGCCCTCTCGCCGCCGGGTGCCATCGCTCCGGCGCCGGCCTCGATGCTGCCGCCGTTCAA
CTCCACCGCCGCCGGCATCTTTGCCGCTCCGGTGCCGTCTCCTGCTCCGGCTCCGGCACC
GATGCATTTCGTCCTTGGTCACCACCACCATCACCGGCACCACCGCCACGGCCTCTAGCT
AATTAATCGAGATCAATCAAGATCATGATTATCAGAGGTTGGGTTTGCATTATTGCACTA
GTTTTTAGCGAGCTACTAGCTAGTTGATCATCACTGCAAGATTGTTAATTAGCGCTAGTA
ATTAGTAAAAGTAAGCCTCTTTTCCTAATCCTATTGTATGCTTTGCTTCTTTCTTCTTCT
TCTGGTTACTGAGAGAGAGTGAGAGTGAGAATGTTTGGTGGTGGGGTATGCATGTCAGAG
ACACGTTTCAAGTCTCTCGTCTTGTAATGTGTCCTTTTTGTGTGGAGCTGCTTTTGAGAA
AGAAAGAAGAGAGATCAAATTT

CDS

396 bp

>Os10t0147400-03 Similar to Auxin transporter-like protein 3.
TTGGATTGGATTGGATTGCAGAACGCGGTGGAGCGGCCGCCGAGGTTCGCCGGAGGATGG
ACGGGGGCGTACGTGATAAACTCGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGCTTCGGC
TTCGGCGGGTGGGCGAGCATCACCAACTTCGTCCACCAGGTCGACACCTTCGGCCTCTTC
GCCAAGTGCTACCAGTGCCCGCCTCACCCCGCCGCCGCCGCCCTCTCGCCGCCGGGTGCC
ATCGCTCCGGCGCCGGCCTCGATGCTGCCGCCGTTCAACTCCACCGCCGCCGGCATCTTT
GCCGCTCCGGTGCCGTCTCCTGCTCCGGCTCCGGCACCGATGCATTTCGTCCTTGGTCAC
CACCACCATCACCGGCACCACCGCCACGGCCTCTAG

Protein

132 aa

>Os10t0147400-03 Similar to Auxin transporter-like protein 3.
LDWIGLQNAVERPPRFAGGWTGAYVINSFVVAWVLVVGFGFGGWASITNFVHQVDTFGLF
AKCYQCPPHPAAAALSPPGAIAPAPASMLPPFNSTAAGIFAAPVPSPAPAPAPMHFVLGH
HHHHRHHRHGL*

5'UTR

chr10:2850353..2851034 (- strand) : 682 bp

CDS

chr10:2849957..2850352 (- strand) : 396 bp

3'UTR

chr10:2849633..2849956 (- strand) : 324 bp

FASTA

>Os10t0147400-03 class=Sequence position=chr10:2849633..2851034 (- strand)
ATGTCTAGAA AGCAACAAAA ATAAAGCTTT CAGCAACAGC ATCATCACAG TATACTAGTA GCAGTAGAAT ACCATCATTC
ACCTAATGAC CTACTTGTGA CATCATCCCA ATGCAAGCTT AACTTATCTT TGCATAATCT TTAATTTCTT CCTGATCTGC
ATCCATATAC TGTTCTGTTT GATTCTGAAA CAGTACATAC AATACATACA GTTGCATGTT CTGTTTCGTA TAATTCGGTA
ACAGTAGTAT AATAACTCAA ACATATATAA TTAAGTAAAG GTGCAATATT ATTAGACTTT TGCATAATCT TTTCTTTCTG
ATCCCTGCAT TCATATATAC TGCTCTCTGT TGGATTCTTG AACAGTAATC TAACTGAAAA TTATAAttag agcaagttta
atagtatagc taactgctga ctctaaatta tctatagtta acttaatagc caattaatag ccaattcata caatagttac
ctataaacat atactacata atcaatattt ggtcccacct gtcatacaca tatgcatttt acagtctgtg ctgtagctgg
cttacaaatc tgtaacccgc tactcttacc tctactcttt tatcttcttg aaatatgctt atagctgact tatagtcagc
tattgtacct gctATCACGA GATGATAGTA ATTAATAACT GATTGGATTG GATTGGATTG CAGAACGCGG TGGAGCGGCC
GCCGAGGTTC GCCGGAGGAT GGACGGGGGC GTACGTGATA AACTCGTTCG TGGTGGCGTG GGTGCTGGTG GTCGGCTTCG
GCTTCGGCGG GTGGGCGAGC ATCACCAACT TCGTCCACCA GGTCGACACC TTCGGCCTCT TCGCCAAGTG CTACCAGTGC
CCGCCTCACC CCGCCGCCGC CGCCCTCTCG CCGCCGGGTG CCATCGCTCC GGCGCCGGCC TCGATGCTGC CGCCGTTCAA
CTCCACCGCC GCCGGCATCT TTGCCGCTCC GGTGCCGTCT CCTGCTCCGG CTCCGGCACC GATGCATTTC GTCCTTGGTC
ACCACCACCA TCACCGGCAC CACCGCCACG GCCTCTAGCT AATTAATCGA GATCAATCAA GATCATGATT ATCAGAGGTT
GGGTTTGCAT TATTGCACTA GTTTTTAGCG AGCTACTAGC TAGTTGATCA TCACTGCAAG ATTGTTAATT AGCGCTAGTA
ATTAGTAAAA GTAAGCCTCT TTTCCTAATC CTATTGTATG CTTTGCTTCT TTCTTCTTCT TCTGGTTACT GAGAGAGAGT
GAGAGTGAGA ATGTTTGGTG GTGGGGTATG CATGTCAGAG ACACGTTTCA AGTCTCTCGT CTTGTAATGT GTCCTTTTTG
TGTGGAGCTG CTTTTGAGAA AGAAAGAAGA GAGATCAAAT TT

Locus: Os10g0147400

Loading...

Locus: Os10g0147400

Loading...