Os10t0148000-01

Locus

Os10g0148000

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTPd11, OsLTP6, OsLtpVI.3, OsDIL, DIL

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein d11, lipid transfer protein d11, type D non-specific lipid transfer protein 11, Drought-Induced LTP, Drought-Induced lipid transfer protein

Transcript Evidence

AK242537 (DDBJ, Best hit)

Protein Evidence

Q10A49 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J080317E23 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0148000-01)

Others

Oryzabase (13552)

KEGG (Os10t0148000-01)

Transcript

457 bp

>Os10t0148000-01 Hypothetical conserved gene.
GCAGCGGCAGGTACAGAATGCCAGAACGATGTCGAGGTGCTGAAGACAACCTGCTACAAG
TTCGTTGAGAAGGACGGGCCGAAGCTGCAGCCATCACCTGACTGCTGCACCTCCATGAAG
GGCGTCAACGTGCCCTGCGTCTGCACCTACCTGGGCAGCCCAGGCGTCAGGGACAACATC
AACATGGATAAGGTGTTCTATGTCACCAAGCAGTGTGGCATCGCCATCCCCGGGAACTGC
GGAGGATCCAAGGTCTAAAACAAGAACTGATTGACTTGGTGAAGTTGGCTGACAAAAGCA
AGGCACCTAGCAGTTGCACGGCTGATATAGGTAAATAATGTTGGTCAACTTTTAGAGTAC
ACGGATTGTACGTCAACCTTCAGCATGTTGTGATAACAAAATATGTATCAATGATGGTTG
TCTATATACACTGAAAATGCAAGAGTATTTTTAAATC

CDS

258 bp

>Os10t0148000-01 Hypothetical conserved gene.
GCAGCGGCAGGTACAGAATGCCAGAACGATGTCGAGGTGCTGAAGACAACCTGCTACAAG
TTCGTTGAGAAGGACGGGCCGAAGCTGCAGCCATCACCTGACTGCTGCACCTCCATGAAG
GGCGTCAACGTGCCCTGCGTCTGCACCTACCTGGGCAGCCCAGGCGTCAGGGACAACATC
AACATGGATAAGGTGTTCTATGTCACCAAGCAGTGTGGCATCGCCATCCCCGGGAACTGC
GGAGGATCCAAGGTCTAA

Protein

86 aa

>Os10t0148000-01 Hypothetical conserved gene.
AAAGTECQNDVEVLKTTCYKFVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNI
NMDKVFYVTKQCGIAIPGNCGGSKV*

CDS

chr10:2885587..2885830 (+ strand) : 244 bp

chr10:2886271..2886284 (+ strand) : 14 bp

3'UTR

chr10:2886285..2886483 (+ strand) : 199 bp

FASTA

>Os10t0148000-01 class=Sequence position=chr10:2885587..2886483 (+ strand)
GCAGCGGCAG GTACAGAATG CCAGAACGAT GTCGAGGTGC TGAAGACAAC CTGCTACAAG TTCGTTGAGA AGGACGGGCC
GAAGCTGCAG CCATCACCTG ACTGCTGCAC CTCCATGAAG GGCGTCAACG TGCCCTGCGT CTGCACCTAC CTGGGCAGCC
CAGGCGTCAG GGACAACATC AACATGGATA AGGTGTTCTA TGTCACCAAG CAGTGTGGCA TCGCCATCCC CGGGAACTGC
GGAGGTGAGC AGGCTTCACT TGATTGGCCA CACTGATCAC CTGGGTAAGA ACTGACAATA ACACGCCGGC TCCTCTGGAT
TGCGACTTCC AGTGGGGCCC AGGTGTCGGT GTCAGCTGGG TAAGTTGGTG TCATCTGGTA TGGGAAACTT TGATGTTTTG
TACATGTGGT GGTGCTCTTG TCAACATTAT ATAGATAAGG AGAGAATAGG ACAAACATGA CGCTTGAATA GCAGAAGAGA
AGTTCTATCC AGCAATATCA AAAGTACAGC TGTCATTTTC AAAAAATGTA AAACAAAAAT AAAACGAAAA ACCCACTATA
CTAGTGCCAA TAAAAGAAGA AACAAAAGAG AACTACATTA TTGTCAATGC CATTTGTTGA TGTTATTATT ACTTTTGTTT
ATAAGAATAA CAATTGTACT TATAAGGCCT ACGATTTATT ACAGGATCCA AGGTCTAAAA CAAGAACTGA TTGACTTGGT
GAAGTTGGCT GACAAAAGCA AGGCACCTAG CAGTTGCACG GCTGATATAG GTAAATAATG TTGGTCAACT TTTAGAGTAC
ACGGATTGTA CGTCAACCTT CAGCATGTTG TGATAACAAA ATATGTATCA ATGATGGTTG TCTATATACA CTGAAAATGC
AAGAGTATTT TTAAATC

Locus: Os10g0148000

Loading...

Locus: Os10g0148000

Loading...