Os10t0148000-02

Locus

Os10g0148000

Description

Lipid transfer protein, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsLTPd11, OsLTP6, OsLtpVI.3, OsDIL, DIL

RAP-DB Gene Name Synonym(s)

non-specific lipid transfer protein d11, lipid transfer protein d11, type D non-specific lipid transfer protein 11, Drought-Induced LTP, Drought-Induced lipid transfer protein

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTPd11, OsLTP6, OsLtpVI.3, OsDIL, DIL

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein d11, lipid transfer protein d11, type D non-specific lipid transfer protein 11, Drought-Induced LTP, Drought-Induced lipid transfer protein

Transcript Evidence

NM_001070697.2

Protein Evidence

Q33B26

Literature

PMID: 23686450

Note

Manual Curation

October 20, 2015

Functional domain (InterPro)

Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain (IPR016140)

Others

Oryzabase (13552)

Transcript

786 bp

>Os10t0148000-02 Lipid transfer protein, Drought tolerance
TTAATCAGAGAAGTTCAAGATATCAGAAAGAACAACACATACCAGGATGTCTCAGCTCAA
GTCTTCTAGCCTGGCTGCACTGCTGATCTTCCTCCTGGCAGTGTTCACCACTGCAGCAGC
AGCGGCAGGTACAGAATGCCAGAACGATGTCGAGGTGCTGAAGACAACCTGCTACAAGTT
CGTTGAGAAGGACGGGCCGAAGCTGCAGCCATCACCTGACTGCTGCACCTCCATGAAGGG
CGTCAACGTGCCCTGCGTCTGCACCTACCTGGGCAGCCCAGGCGTCAGGGACAACATCAA
CATGGATAAGGTGTTCTATGTCACCAAGCAGTGTGGCATCGCCATCCCCGGGAACTGCGG
AGGTGAGCAGGCTTCACTTGATTGGCCACACTGATCACCTGGGTAAGAACTGACAATAAC
ACGCCGGCTCCTCTGGATTGCGACTTCCAGTGGGGCCCAGGTGTCGGTGTCAGCTGGGAT
CCAAGGTCTAAAACAAGAACTGATTGACTTGGTGAAGTTGGCTGACAAAAGCAAGGCACC
TAGCAGTTGCACGGCTGATATAGGTAAATAATGTTGGTCAACTTTTAGAGTACACGGATT
GTACGTCAACCTTCAGCATGTTGTGATAACAAAATATGTATCAATGATGGTTGTCTATAT
ACACTGAAAATGCAAGAGTATTTTTAAATCACATGTTGTATTGAGTATTGACCCAGCTAT
CAACTGTTTGTTGATGTGCCCTGTTCCTTAGTCTGATAAATGCTAATATAGCACATTGCT
AAAAGC

CDS

348 bp

>Os10t0148000-02 Lipid transfer protein, Drought tolerance
ATGTCTCAGCTCAAGTCTTCTAGCCTGGCTGCACTGCTGATCTTCCTCCTGGCAGTGTTC
ACCACTGCAGCAGCAGCGGCAGGTACAGAATGCCAGAACGATGTCGAGGTGCTGAAGACA
ACCTGCTACAAGTTCGTTGAGAAGGACGGGCCGAAGCTGCAGCCATCACCTGACTGCTGC
ACCTCCATGAAGGGCGTCAACGTGCCCTGCGTCTGCACCTACCTGGGCAGCCCAGGCGTC
AGGGACAACATCAACATGGATAAGGTGTTCTATGTCACCAAGCAGTGTGGCATCGCCATC
CCCGGGAACTGCGGAGGTGAGCAGGCTTCACTTGATTGGCCACACTGA

Protein

116 aa

>Os10t0148000-02 Lipid transfer protein, Drought tolerance
MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYKFVEKDGPKLQPSPDCC
TSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPGNCGGEQASLDWPH*

5'UTR

chr10:2885469..2885514 (+ strand) : 46 bp

CDS

chr10:2885515..2885862 (+ strand) : 348 bp

3'UTR

chr10:2885863..2885945 (+ strand) : 83 bp

chr10:2886271..2886579 (+ strand) : 309 bp

FASTA

>Os10t0148000-02 class=Sequence position=chr10:2885469..2886579 (+ strand)
TTAATCAGAG AAGTTCAAGA TATCAGAAAG AACAACACAT ACCAGGATGT CTCAGCTCAA GTCTTCTAGC CTGGCTGCAC
TGCTGATCTT CCTCCTGGCA GTGTTCACCA CTGCAGCAGC AGCGGCAGGT ACAGAATGCC AGAACGATGT CGAGGTGCTG
AAGACAACCT GCTACAAGTT CGTTGAGAAG GACGGGCCGA AGCTGCAGCC ATCACCTGAC TGCTGCACCT CCATGAAGGG
CGTCAACGTG CCCTGCGTCT GCACCTACCT GGGCAGCCCA GGCGTCAGGG ACAACATCAA CATGGATAAG GTGTTCTATG
TCACCAAGCA GTGTGGCATC GCCATCCCCG GGAACTGCGG AGGTGAGCAG GCTTCACTTG ATTGGCCACA CTGATCACCT
GGGTAAGAAC TGACAATAAC ACGCCGGCTC CTCTGGATTG CGACTTCCAG TGGGGCCCAG GTGTCGGTGT CAGCTGGGTA
AGTTGGTGTC ATCTGGTATG GGAAACTTTG ATGTTTTGTA CATGTGGTGG TGCTCTTGTC AACATTATAT AGATAAGGAG
AGAATAGGAC AAACATGACG CTTGAATAGC AGAAGAGAAG TTCTATCCAG CAATATCAAA AGTACAGCTG TCATTTTCAA
AAAATGTAAA ACAAAAATAA AACGAAAAAC CCACTATACT AGTGCCAATA AAAGAAGAAA CAAAAGAGAA CTACATTATT
GTCAATGCCA TTTGTTGATG TTATTATTAC TTTTGTTTAT AAGAATAACA ATTGTACTTA TAAGGCCTAC GATTTATTAC
AGGATCCAAG GTCTAAAACA AGAACTGATT GACTTGGTGA AGTTGGCTGA CAAAAGCAAG GCACCTAGCA GTTGCACGGC
TGATATAGGT AAATAATGTT GGTCAACTTT TAGAGTACAC GGATTGTACG TCAACCTTCA GCATGTTGTG ATAACAAAAT
ATGTATCAAT GATGGTTGTC TATATACACT GAAAATGCAA GAGTATTTTT AAATCACATG TTGTATTGAG TATTGACCCA
GCTATCAACT GTTTGTTGAT GTGCCCTGTT CCTTAGTCTG ATAAATGCTA ATATAGCACA TTGCTAAAAG C

Locus: Os10g0148000

Loading...

Locus: Os10g0148000

Loading...