Os10t0154700-01

Locus

Os10g0154700

Description

Similar to Cyclophilin Dicyp-2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP18-4

CGSNL Gene Name

CYCLOPHILIN 18-4

Oryzabase Gene Symbol Synonym(s)

OsCYP18-4, OsCYP-26, OsCYP18-3

Oryzabase Gene Name Synonym(s)

cyclophilin 18-4, cyclophilin 26

Transcript Evidence

AK058898 (DDBJ, Best hit)

Protein Evidence

A2Z550 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

001-007-H03 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0154700-01)

RiceXPro (AK058898)

Others

Oryzabase (10056)

KEGG (Os10t0154700-01 (EC:5.2.1.8))

Transcript

924 bp

>Os10t0154700-01 Similar to Cyclophilin Dicyp-2.
AAGTCTCAAACCAAGAGACAACAAGTCACAATTTCTCATAGACAAGTAGCTATCTATCTC
TATCTAGCAAGCTAGCTAGGTTGCTTGCATTCTCTCCTCTCTCTCTTCCTGTGTCACCAA
TGGCGCCGGCGGCGTCCTCCAAGTCCAACCCAAGGGTGTTCCTTGACATCGCCATCGGCG
GCGAGTGGGTTGGCCGCGTGGTGATCGAGCTGCTCGCCGACAAGGTGCCCGACACGGCGG
AGAACTTCCGGCGGCTGTGCACCGGCGAGCGCGCCGGGCGCTCCGGCAAGAGCAGGCTCC
ACTACAAGGGGTCGGCGTTCCACCGCGTGGTGCCCGGGTTCATGTGCCAGGGCGGCGACA
TCACGGCCGGGAACGGCACCGGCGGCGAGTCGGCGCTGGACGGCGCCGCGAGGCACTTCC
CCGACGAGGGGTTCGCGGTGAAGCACGACGGGCCCGGGGTGGTGTCCATGGCGAACGCCG
GGCCCAACACCAACGGCTCCCAGTTCTTCATCACCGTCGACAAGGCGCCGTGGCTGGACG
GCCGCCACGTCGCGTTCGGCCGCGTCGTCGCCGGGATGGGCGCCGTCCGCGCCATCGACA
GGACGGGAACCTGGAGCGGCAAGACGGTGAAGCCCGTCGTCATCACCGACTGCGGCGTGC
TCTAGAAATACATATACATACGTATATATGCCAGTGTATACCGTATACGTACGTGTACCG
GTGTACGTACGTATGCTGTACGGTTCGGTATACATTAAAATTGTGTCTACTCTAGCTACT
GTGTGATGAGCGTATGAGAGTGTTAGCTGATGTAATTTTTTGAGGTTGCGACATGGTGGT
TACAAACTATCGAGGACGTTAGCTGCCTCACTGATGGTGACTTAATCTAGCTACCAGATA
ATAAAATTGAGTGATTGAGCACAT

CDS

546 bp

>Os10t0154700-01 Similar to Cyclophilin Dicyp-2.
ATGGCGCCGGCGGCGTCCTCCAAGTCCAACCCAAGGGTGTTCCTTGACATCGCCATCGGC
GGCGAGTGGGTTGGCCGCGTGGTGATCGAGCTGCTCGCCGACAAGGTGCCCGACACGGCG
GAGAACTTCCGGCGGCTGTGCACCGGCGAGCGCGCCGGGCGCTCCGGCAAGAGCAGGCTC
CACTACAAGGGGTCGGCGTTCCACCGCGTGGTGCCCGGGTTCATGTGCCAGGGCGGCGAC
ATCACGGCCGGGAACGGCACCGGCGGCGAGTCGGCGCTGGACGGCGCCGCGAGGCACTTC
CCCGACGAGGGGTTCGCGGTGAAGCACGACGGGCCCGGGGTGGTGTCCATGGCGAACGCC
GGGCCCAACACCAACGGCTCCCAGTTCTTCATCACCGTCGACAAGGCGCCGTGGCTGGAC
GGCCGCCACGTCGCGTTCGGCCGCGTCGTCGCCGGGATGGGCGCCGTCCGCGCCATCGAC
AGGACGGGAACCTGGAGCGGCAAGACGGTGAAGCCCGTCGTCATCACCGACTGCGGCGTG
CTCTAG

Protein

182 aa

>Os10t0154700-01 Similar to Cyclophilin Dicyp-2.
MAPAASSKSNPRVFLDIAIGGEWVGRVVIELLADKVPDTAENFRRLCTGERAGRSGKSRL
HYKGSAFHRVVPGFMCQGGDITAGNGTGGESALDGAARHFPDEGFAVKHDGPGVVSMANA
GPNTNGSQFFITVDKAPWLDGRHVAFGRVVAGMGAVRAIDRTGTWSGKTVKPVVITDCGV
L*

5'UTR

chr10:3438474..3438592 (+ strand) : 119 bp

CDS

chr10:3438593..3439138 (+ strand) : 546 bp

3'UTR

chr10:3439139..3439397 (+ strand) : 259 bp

FASTA

>Os10t0154700-01 class=Sequence position=chr10:3438474..3439397 (+ strand)
AAGTCTCAAA CCAAGAGACA ACAAGTCACA ATTTCTCATA GACAAGTAGC TATCTATCTC TATCTAGCAA GCTAGCTAGG
TTGCTTGCAT TCTCTCCTCT CTCTCTTCCT GTGTCACCAA TGGCGCCGGC GGCGTCCTCC AAGTCCAACC CAAGGGTGTT
CCTTGACATC GCCATCGGCG GCGAGTGGGT TGGCCGCGTG GTGATCGAGC TGCTCGCCGA CAAGGTGCCC GACACGGCGG
AGAACTTCCG GCGGCTGTGC ACCGGCGAGC GCGCCGGGCG CTCCGGCAAG AGCAGGCTCC ACTACAAGGG GTCGGCGTTC
CACCGCGTGG TGCCCGGGTT CATGTGCCAG GGCGGCGACA TCACGGCCGG GAACGGCACC GGCGGCGAGT CGGCGCTGGA
CGGCGCCGCG AGGCACTTCC CCGACGAGGG GTTCGCGGTG AAGCACGACG GGCCCGGGGT GGTGTCCATG GCGAACGCCG
GGCCCAACAC CAACGGCTCC CAGTTCTTCA TCACCGTCGA CAAGGCGCCG TGGCTGGACG GCCGCCACGT CGCGTTCGGC
CGCGTCGTCG CCGGGATGGG CGCCGTCCGC GCCATCGACA GGACGGGAAC CTGGAGCGGC AAGACGGTGA AGCCCGTCGT
CATCACCGAC TGCGGCGTGC TCTAGAAATA CATATACATA CGTATATATG CCAGTGTATA CCGTATACGT ACGTGTACCG
GTGTACGTAC GTATGCTGTA CGGTTCGGTA TACATTAAAA TTGTGTCTAC TCTAGCTACT GTGTGATGAG CGTATGAGAG
TGTTAGCTGA TGTAATTTTT TGAGGTTGCG ACATGGTGGT TACAAACTAT CGAGGACGTT AGCTGCCTCA CTGATGGTGA
CTTAATCTAG CTACCAGATA ATAAAATTGA GTGATTGAGC ACAT

Locus: Os10g0154700

Loading...

Locus: Os10g0154700

Loading...