Os10t0180800-01

Locus

Os10g0180800

Description

Wall-associated kinase, Negative regulation of rice blast resistance

RAP-DB Gene Symbol Synonym(s)

WAK112, OsWAK112, OsWAK112d

RAP-DB Gene Name Synonym(s)

WALL-ASSOCIATED KINASE GENE 112, cell wall associated receptor kinase 112, cell wall associated receptor kinase 112d

CGSNL Gene Symbol

WAK112

CGSNL Gene Name

WALL-ASSOCIATED KINASE GENE 112

Oryzabase Gene Symbol Synonym(s)

OsWAK112, OsWAK112d

Oryzabase Gene Name Synonym(s)

cell wall associated receptor kinase 112, cell wall associated receptor kinase 112d

Transcript Evidence

AK099018

Protein Evidence

Q33AH5

Literature

PMID: 26772971

Note

Manual Curation

January 27, 2016

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: polysaccharide binding (GO:0030247)

Functional domain (InterPro)

Wall-associated receptor kinase, galacturonan-binding domain (IPR025287)

EGF-like domain (IPR000742)

Growth factor receptor cysteine-rich domain (IPR009030)

EGF-like calcium-binding domain (IPR001881)

Concanavalin A-like lectin/glucanase domain (IPR013320)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

EGF-like calcium-binding, conserved site (IPR018097)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J013116L16 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0180800-01)

Others

Oryzabase (8029)

Transcript

3099 bp

>Os10t0180800-01 Wall-associated kinase, Negative regulation of rice blast resistance
GCACATGCTTAGCTAGACATGCTTATGTTGTTACTAAACATACGTAGACAAGTCCAAACT
TTATACTTGAGAGAATCGAGTATCTCTGTAGCAAGAGTTCAGATGGGCCACCTCAATATC
ATGTTAGCTTTCCTTTCATTTGTGTTATTAGGGTTAGCTGAAGTCGAGGGAACTGTAGCA
CTGAGTCAAATCCTCTCAAATAGCCATCTGATCACCCCGTACCGAGAGGTTACGGCAAGA
AAGTTTGAGAGAAGGTCCTTACTGCAGGATCATAGTAGTGATGATAGGAGATCATCTAAT
GCAAGCCTTCCCTCTGCTGCCACACTTGCTAACTGTCCAAAGCGATGCGGCAACTTGAGC
TTCGACTATCCCTTCGGCATAGGAGATGGTTGTTTCCGCCATCCCGATTTCAGTCTCACA
TGCAACGCCACTACTCAGCCTCCCAAACTCCTCTTGCATATTAACGAAAGCGTGGAGGTT
ATAGATAATATTGAGGTCGTCGGTAAGGATATAGCTGAGTTTTTCTACTTCAACTTCTTT
ATGGTCGCATTTAACCATCTCATCCCCATAAAAGCTGGTGTCGATGTCTATAACCTTACA
TGGAAAGCCCCAGGGATTTCTTTTACTATTTCAGAGATGATGATAATTACTGTCGTCAGC
TGCGACTTGGATGTATTCTTGATAGGCCAAGACAACACTCCTAAACTGCTTTGCATGGTT
GCTTGTCCCAACAAAGAGATTGCAGACATGGTGTACATGCAAGACTGTGAAGGCCCTGGC
TGTTGTACTGTATTATCTGAAACACCAGTTCAGGCTGTACAATTGCAGTTTGTTCGCCAT
GAGACAAGTAATGCTGGAAAAATCTCCAATCTCAGCATGCTATGGGATAGAATCAACATA
ACTATTGGGGCGCCACTTGTTTGGAGTATTGTTGACCAAACAAGATGCTCAAGAAACATG
GAAGATAACTTCGCTTGTGTCAGCAACCACAGTGGGTGCATAACTTCTGTGTTTAGAGAT
ATTGGCTATGCCTGCCAATGCAATTCTGGCTACAAGGGAAATCCTTTTATCCTTGATGGT
TGCAAGCATGACAGCGGTTACAACCCTAGACCAGAAAAGCATAATTGCGCTCGACAATGT
GGGACAATCACAGTCCCGTTTCCGTTTGGCCTTGAAGAGGGTTGCTCCGCAAGGAAACGT
TTTCAGCTCAACTGCTCCGACAAGACAAATTCGGTCCTCAAGTTCAATGACTATTTTCAG
GTGACGTATATAAATGTCAGTGAAGGACTTCTGGGCATCAAACACAACTCATCGCTGGAG
GAGCAACTATTCAATATAATGATGGAAATGATGACTTCTGATAATGAGCCAGACCTATTT
GTTGACCCTCTTGAATCAGTCTCTGTGCAATGGGCCGTTGCCAACCTGACATGCCAAGAG
GCGCAACACAACACTTCTGGATATGCATGTGTAAGTACCAGCAGCTCCTGCTTGAATGTC
CTTAGCTCCATGGATGGTTATGTTGGCTACAGATGCAGTTGCTTGCCTGGTTATCGTGGA
AATCCATACATCCTAGATGGCTGCGAAGATATCGACGAGTGCCGAGAGACACCAGGAATT
TGTAAAGGAGTTTGCAAGAATACCGTTGGAAACTACAGCTGCACCAAGTGCCCTGATCAT
ACCGAGTACGATATTTTAAGAATGCAGTGTACTCCAATAAGAAAGAAAAGCTTCTACTTA
GGTATTATAATTGGCCTTAGCAGTGGCTTTGGAATGCTACTTCTTGGATTAAGTGGAATA
GTTCTCATTCGAAGATGGAAAAGACATGCACAGAAAAGACTGCAGACGAAGTATTTCCGA
AAGAACCAGGGCCTTCTATTGGAACAATTGATATCATCGGATGAAAATGCTAGTGAGAAG
ACAAAAATTTTCTCCTTAGAAGAGCTTAAAAAGGCGACAAATAACTTTGATACCACACGT
ATCCTTGGCCGTGGAGGGCATGGAACAGTATACAAAGGTATCTTATCTAACCAACATGTG
GTGGCTATTAAAAAGGCCAAAGTTATAAGGGAATGCGAGATTAATGATTTCATCAACGAG
GTTTCGATTCTTTCTCAGATAAATCACCGAAATATTGTTAAACTCTTTGGATGCTGTCTT
GAAACTGAGGTCCCCTTATTAGTCTATGATTTTATTCCCAATGGTTCATTGTTCGGACTA
CTTCATCCAGATTCCAGTAGCACAATCTATTTATCATGGGGTGACTGCCTAAGGATTGCA
GCAGAAGCAGCTGGAGCTCTATATTATCTCCACTCTGCAGCATCAATTTCCATCTTCCAC
CGTGATGTGAAGTCATCTAATATACTCTTGGATGCAAACTATACTGCTAAAGTTTCAGAT
TTTGGTGCTTCAAGATCAGTTCCCATCGATCAAACCCATATCATCACAAATGTACAGGGT
ACATTTGGTTACTTGGATCCAGAATATTACCAAACTAggcagctaaatgagaagagtgat
gtctatagttttggtgtggtactcctagaacttCTTCTGAGAAAGCAACCCATTTTTACA
ATAAACTCTGGGATGAAACAAAATTTGTGTAGTTACTTCCTTTCAGAGATTAAAACCAGG
CCAATTACAGATATGGTCGATGCTCAAGTTCTCGAAGAAGCAAATGAGGAAGATATCAAA
GAAGTTGCATCCCTTGCTGAGATGTGCTTGAAGCTAAAAGGTGAAGAAAGGCCCACGATG
AAGAAAGTAGAGATGACGTTACAGCTTCTGCGAACAAAAACGATGAACTCATCTCAAGTA
GATCCAACCATTGACCAAGAGATTCAAACTGTTCTGACTGAAGGAGCCAGTGACCCAGAG
ATACAACCATTAGTAACAAATTTGGATGTTGATAGAGCTAATGCAGCATCTCAACGCTTC
CAAATATCATGCTATAGCTTGGAGCAAGAATTCTTGTCATCTGCTAGCTTACCACGGTAG
ATGTGTTTATCCTATTTCTGATGTGTTTAGTTAACTTGCATATGTATTGTGTACTTGCAG
TCATGTATGTTGAAATGAGAAATTATACTATATGCCATC

CDS

2982 bp

>Os10t0180800-01 Wall-associated kinase, Negative regulation of rice blast resistance
ATGCTTATGTTGTTACTAAACATACGTAGACAAGTCCAAACTTTATACTTGAGAGAATCG
AGTATCTCTGTAGCAAGAGTTCAGATGGGCCACCTCAATATCATGTTAGCTTTCCTTTCA
TTTGTGTTATTAGGGTTAGCTGAAGTCGAGGGAACTGTAGCACTGAGTCAAATCCTCTCA
AATAGCCATCTGATCACCCCGTACCGAGAGGTTACGGCAAGAAAGTTTGAGAGAAGGTCC
TTACTGCAGGATCATAGTAGTGATGATAGGAGATCATCTAATGCAAGCCTTCCCTCTGCT
GCCACACTTGCTAACTGTCCAAAGCGATGCGGCAACTTGAGCTTCGACTATCCCTTCGGC
ATAGGAGATGGTTGTTTCCGCCATCCCGATTTCAGTCTCACATGCAACGCCACTACTCAG
CCTCCCAAACTCCTCTTGCATATTAACGAAAGCGTGGAGGTTATAGATAATATTGAGGTC
GTCGGTAAGGATATAGCTGAGTTTTTCTACTTCAACTTCTTTATGGTCGCATTTAACCAT
CTCATCCCCATAAAAGCTGGTGTCGATGTCTATAACCTTACATGGAAAGCCCCAGGGATT
TCTTTTACTATTTCAGAGATGATGATAATTACTGTCGTCAGCTGCGACTTGGATGTATTC
TTGATAGGCCAAGACAACACTCCTAAACTGCTTTGCATGGTTGCTTGTCCCAACAAAGAG
ATTGCAGACATGGTGTACATGCAAGACTGTGAAGGCCCTGGCTGTTGTACTGTATTATCT
GAAACACCAGTTCAGGCTGTACAATTGCAGTTTGTTCGCCATGAGACAAGTAATGCTGGA
AAAATCTCCAATCTCAGCATGCTATGGGATAGAATCAACATAACTATTGGGGCGCCACTT
GTTTGGAGTATTGTTGACCAAACAAGATGCTCAAGAAACATGGAAGATAACTTCGCTTGT
GTCAGCAACCACAGTGGGTGCATAACTTCTGTGTTTAGAGATATTGGCTATGCCTGCCAA
TGCAATTCTGGCTACAAGGGAAATCCTTTTATCCTTGATGGTTGCAAGCATGACAGCGGT
TACAACCCTAGACCAGAAAAGCATAATTGCGCTCGACAATGTGGGACAATCACAGTCCCG
TTTCCGTTTGGCCTTGAAGAGGGTTGCTCCGCAAGGAAACGTTTTCAGCTCAACTGCTCC
GACAAGACAAATTCGGTCCTCAAGTTCAATGACTATTTTCAGGTGACGTATATAAATGTC
AGTGAAGGACTTCTGGGCATCAAACACAACTCATCGCTGGAGGAGCAACTATTCAATATA
ATGATGGAAATGATGACTTCTGATAATGAGCCAGACCTATTTGTTGACCCTCTTGAATCA
GTCTCTGTGCAATGGGCCGTTGCCAACCTGACATGCCAAGAGGCGCAACACAACACTTCT
GGATATGCATGTGTAAGTACCAGCAGCTCCTGCTTGAATGTCCTTAGCTCCATGGATGGT
TATGTTGGCTACAGATGCAGTTGCTTGCCTGGTTATCGTGGAAATCCATACATCCTAGAT
GGCTGCGAAGATATCGACGAGTGCCGAGAGACACCAGGAATTTGTAAAGGAGTTTGCAAG
AATACCGTTGGAAACTACAGCTGCACCAAGTGCCCTGATCATACCGAGTACGATATTTTA
AGAATGCAGTGTACTCCAATAAGAAAGAAAAGCTTCTACTTAGGTATTATAATTGGCCTT
AGCAGTGGCTTTGGAATGCTACTTCTTGGATTAAGTGGAATAGTTCTCATTCGAAGATGG
AAAAGACATGCACAGAAAAGACTGCAGACGAAGTATTTCCGAAAGAACCAGGGCCTTCTA
TTGGAACAATTGATATCATCGGATGAAAATGCTAGTGAGAAGACAAAAATTTTCTCCTTA
GAAGAGCTTAAAAAGGCGACAAATAACTTTGATACCACACGTATCCTTGGCCGTGGAGGG
CATGGAACAGTATACAAAGGTATCTTATCTAACCAACATGTGGTGGCTATTAAAAAGGCC
AAAGTTATAAGGGAATGCGAGATTAATGATTTCATCAACGAGGTTTCGATTCTTTCTCAG
ATAAATCACCGAAATATTGTTAAACTCTTTGGATGCTGTCTTGAAACTGAGGTCCCCTTA
TTAGTCTATGATTTTATTCCCAATGGTTCATTGTTCGGACTACTTCATCCAGATTCCAGT
AGCACAATCTATTTATCATGGGGTGACTGCCTAAGGATTGCAGCAGAAGCAGCTGGAGCT
CTATATTATCTCCACTCTGCAGCATCAATTTCCATCTTCCACCGTGATGTGAAGTCATCT
AATATACTCTTGGATGCAAACTATACTGCTAAAGTTTCAGATTTTGGTGCTTCAAGATCA
GTTCCCATCGATCAAACCCATATCATCACAAATGTACAGGGTACATTTGGTTACTTGGAT
CCAGAATATTACCAAACTAggcagctaaatgagaagagtgatgtctatagttttggtgtg
gtactcctagaacttCTTCTGAGAAAGCAACCCATTTTTACAATAAACTCTGGGATGAAA
CAAAATTTGTGTAGTTACTTCCTTTCAGAGATTAAAACCAGGCCAATTACAGATATGGTC
GATGCTCAAGTTCTCGAAGAAGCAAATGAGGAAGATATCAAAGAAGTTGCATCCCTTGCT
GAGATGTGCTTGAAGCTAAAAGGTGAAGAAAGGCCCACGATGAAGAAAGTAGAGATGACG
TTACAGCTTCTGCGAACAAAAACGATGAACTCATCTCAAGTAGATCCAACCATTGACCAA
GAGATTCAAACTGTTCTGACTGAAGGAGCCAGTGACCCAGAGATACAACCATTAGTAACA
AATTTGGATGTTGATAGAGCTAATGCAGCATCTCAACGCTTCCAAATATCATGCTATAGC
TTGGAGCAAGAATTCTTGTCATCTGCTAGCTTACCACGGTAG

Protein

994 aa

>Os10t0180800-01 Wall-associated kinase, Negative regulation of rice blast resistance
MLMLLLNIRRQVQTLYLRESSISVARVQMGHLNIMLAFLSFVLLGLAEVEGTVALSQILS
NSHLITPYREVTARKFERRSLLQDHSSDDRRSSNASLPSAATLANCPKRCGNLSFDYPFG
IGDGCFRHPDFSLTCNATTQPPKLLLHINESVEVIDNIEVVGKDIAEFFYFNFFMVAFNH
LIPIKAGVDVYNLTWKAPGISFTISEMMIITVVSCDLDVFLIGQDNTPKLLCMVACPNKE
IADMVYMQDCEGPGCCTVLSETPVQAVQLQFVRHETSNAGKISNLSMLWDRINITIGAPL
VWSIVDQTRCSRNMEDNFACVSNHSGCITSVFRDIGYACQCNSGYKGNPFILDGCKHDSG
YNPRPEKHNCARQCGTITVPFPFGLEEGCSARKRFQLNCSDKTNSVLKFNDYFQVTYINV
SEGLLGIKHNSSLEEQLFNIMMEMMTSDNEPDLFVDPLESVSVQWAVANLTCQEAQHNTS
GYACVSTSSSCLNVLSSMDGYVGYRCSCLPGYRGNPYILDGCEDIDECRETPGICKGVCK
NTVGNYSCTKCPDHTEYDILRMQCTPIRKKSFYLGIIIGLSSGFGMLLLGLSGIVLIRRW
KRHAQKRLQTKYFRKNQGLLLEQLISSDENASEKTKIFSLEELKKATNNFDTTRILGRGG
HGTVYKGILSNQHVVAIKKAKVIRECEINDFINEVSILSQINHRNIVKLFGCCLETEVPL
LVYDFIPNGSLFGLLHPDSSSTIYLSWGDCLRIAAEAAGALYYLHSAASISIFHRDVKSS
NILLDANYTAKVSDFGASRSVPIDQTHIITNVQGTFGYLDPEYYQTRQLNEKSDVYSFGV
VLLELLLRKQPIFTINSGMKQNLCSYFLSEIKTRPITDMVDAQVLEEANEEDIKEVASLA
EMCLKLKGEERPTMKKVEMTLQLLRTKTMNSSQVDPTIDQEIQTVLTEGASDPEIQPLVT
NLDVDRANAASQRFQISCYSLEQEFLSSASLPR*

5'UTR

chr10:5544561..5544578 (- strand) : 18 bp

CDS

chr10:5543483..5544560 (- strand) : 1078 bp

chr10:5541807..5542298 (- strand) : 492 bp

chr10:5541184..5541336 (- strand) : 153 bp

chr10:5539842..5541100 (- strand) : 1259 bp

3'UTR

chr10:5539743..5539841 (- strand) : 99 bp

FASTA

>Os10t0180800-01 class=Sequence position=chr10:5539743..5544578 (- strand)
GCACATGCTT AGCTAGACAT GCTTATGTTG TTACTAAACA TACGTAGACA AGTCCAAACT TTATACTTGA GAGAATCGAG
TATCTCTGTA GCAAGAGTTC AGATGGGCCA CCTCAATATC ATGTTAGCTT TCCTTTCATT TGTGTTATTA GGGTTAGCTG
AAGTCGAGGG AACTGTAGCA CTGAGTCAAA TCCTCTCAAA TAGCCATCTG ATCACCCCGT ACCGAGAGGT TACGGCAAGA
AAGTTTGAGA GAAGGTCCTT ACTGCAGGAT CATAGTAGTG ATGATAGGAG ATCATCTAAT GCAAGCCTTC CCTCTGCTGC
CACACTTGCT AACTGTCCAA AGCGATGCGG CAACTTGAGC TTCGACTATC CCTTCGGCAT AGGAGATGGT TGTTTCCGCC
ATCCCGATTT CAGTCTCACA TGCAACGCCA CTACTCAGCC TCCCAAACTC CTCTTGCATA TTAACGAAAG CGTGGAGGTT
ATAGATAATA TTGAGGTCGT CGGTAAGGAT ATAGCTGAGT TTTTCTACTT CAACTTCTTT ATGGTCGCAT TTAACCATCT
CATCCCCATA AAAGCTGGTG TCGATGTCTA TAACCTTACA TGGAAAGCCC CAGGGATTTC TTTTACTATT TCAGAGATGA
TGATAATTAC TGTCGTCAGC TGCGACTTGG ATGTATTCTT GATAGGCCAA GACAACACTC CTAAACTGCT TTGCATGGTT
GCTTGTCCCA ACAAAGAGAT TGCAGACATG GTGTACATGC AAGACTGTGA AGGCCCTGGC TGTTGTACTG TATTATCTGA
AACACCAGTT CAGGCTGTAC AATTGCAGTT TGTTCGCCAT GAGACAAGTA ATGCTGGAAA AATCTCCAAT CTCAGCATGC
TATGGGATAG AATCAACATA ACTATTGGGG CGCCACTTGT TTGGAGTATT GTTGACCAAA CAAGATGCTC AAGAAACATG
GAAGATAACT TCGCTTGTGT CAGCAACCAC AGTGGGTGCA TAACTTCTGT GTTTAGAGAT ATTGGCTATG CCTGCCAATG
CAATTCTGGC TACAAGGGAA ATCCTTTTAT CCTTGATGGT TGCAAGCATG ACAGCGGTAA CTTTCTCCAC CATACCTTAA
TTATCGTATT AATTTAAAAG ATAAGGATAG CAATCCGGCC TCTATATCTA CAGTAGTCAG TAGATATACC TTGTCGTCGT
ATTACATTTA AAAAAACAAA AGTCACTGTT TTAGTACTTT AAATATCCAA GCATTTGATT TTAGTACTGA AAGTCTGAAA
TCAACATGCA CAATCATCTG ATTTTGACCT GACATTTGGG AGTTGGGACC GATTGTAATT TGTAACCCTT TCTCTTGTCT
TCACCATGCT ATTTGACGCA ATGAACAGGA TGAGGTAAGT AATATGCTGA CGGAGCAATT GAATGTCATA TTCAGGATCA
AGTATATTCC TCTTTAATTC CAGGGAACTG ACAAAAAAAC GAATTATTCA GCAACCACAC GAGTAAGTTC TTGTCAGTTT
CCACCCTAGG AAGATCAGCT CGGAATATTT TTAGCCACTT GACATTTTTG TCAAAAAATT TGGGAACTTC TGGGATAATT
GGGTTTGCAG ATAGAATTTT CTCCCATAAT TAGTGAATAT ATACTTCTGG GGCAAACATA TTTTCCACTT TTTTTTCCTT
CTACTAGGAT AAACAGTATA TACTGGATTT TATTATTTCC ATTTATTCAT TTTGGAAATG AAAACATTAT CTCTCTTTTA
CCGATACCAT ATTTTGTGGT CAACAATAGA TGACTATACA GTACTTTGAT GTTCTCGTAC AAAATGAAAA TGCACTATTA
ATCCACTTTA TCTATGCGTA AATACATGCA TCACTCATTT TTACAAATAC AACTAGGACA TGTATGCGAT cacatcctat
gtacacaagc tttgcatgta aacatcgtgc acaccaacta acaaatatca cagaaaaatc taaagtatta tatcccaata
taaaatctta acctcaaatt tattatattt ttacctaaaa ataaaaattt gataatttta aactcaaatt tattatatct
ttttagatct aatttgaaga taaaatgtat ccgtgcaatt ttatctataa ttttcggtga tatttgttgt tagtgtgcac
ggtatgtaca caggaaggct tatgtgtata cgatTATGTT TCCAACATGT ATACCCTTTT ACCAGAAACA ACGAGAACAC
TTGGAGATGG GGCATAACAT GGAGTTTTTA CTGATGCCAG GTTACAACCC TAGACCAGAA AAGCATAATT GCGCTCGACA
ATGTGGGACA ATCACAGTCC CGTTTCCGTT TGGCCTTGAA GAGGGTTGCT CCGCAAGGAA ACGTTTTCAG CTCAACTGCT
CCGACAAGAC AAATTCGGTC CTCAAGTTCA ATGACTATTT TCAGGTGACG TATATAAATG TCAGTGAAGG ACTTCTGGGC
ATCAAACACA ACTCATCGCT GGAGGAGCAA CTATTCAATA TAATGATGGA AATGATGACT TCTGATAATG AGCCAGACCT
ATTTGTTGAC CCTCTTGAAT CAGTCTCTGT GCAATGGGCC GTTGCCAACC TGACATGCCA AGAGGCGCAA CACAACACTT
CTGGATATGC ATGTGTAAGT ACCAGCAGCT CCTGCTTGAA TGTCCTTAGC TCCATGGATG GTTATGTTGG CTACAGATGC
AGTTGCTTGC CTGGTTATCG TGGAAATCCA TACATCCTAG ATGGCTGCGA AGGTAATTCA CCAACTTCAT CCCCCAAATT
AAACATGATT GCTGCAAAGG TCACATTGAA TTCAAATCTT TGATATTTAA ACAACGAAAA ACATCGACCA TTATGGCCTA
ACAGAGTCAA CGATACCAAT CACCAATGCT GAAACATCAA ATTTCAAATG ATGTTCGAGT GGCTGCTCTT CCCTACTGTC
ATATTTTTAT CCTGATCAGT AAATTTTATT AAATTAACTA TTAAATAATC ACAATTTCTC TTATTTTCTA CAAATTGAAC
GATGTTCTTG CATACAAAGC AAAGAGTTCC TCATGGAAAT TATCTGACTA TCAAACATAC ATAAGTCCCC AATGTTTTCT
TAATATTTAT CATTCTAGTG TGATAAAAAG AATCATGTGG CCAATATTTT ATTTGGTACA TAAATACAGT TTTTTGTTCA
AAATTATATA TTGCCTTACT GAGATGTGTT TACCGGTTAC AGATATCGAC GAGTGCCGAG AGACACCAGG AATTTGTAAA
GGAGTTTGCA AGAATACCGT TGGAAACTAC AGCTGCACCA AGTGCCCTGA TCATACCGAG TACGATATTT TAAGAATGCA
GTGTACTCCA ATAAGAAAGA AAAGCTTCTA CTTAGGTGAG TCCTAATGTC CTATAGTGAT CAAACAACAC TGGTAGAGGG
TGCATTGATA TATATCATAG GGGATTTTAT CATTGTAGGT ATTATAATTG GCCTTAGCAG TGGCTTTGGA ATGCTACTTC
TTGGATTAAG TGGAATAGTT CTCATTCGAA GATGGAAAAG ACATGCACAG AAAAGACTGC AGACGAAGTA TTTCCGAAAG
AACCAGGGCC TTCTATTGGA ACAATTGATA TCATCGGATG AAAATGCTAG TGAGAAGACA AAAATTTTCT CCTTAGAAGA
GCTTAAAAAG GCGACAAATA ACTTTGATAC CACACGTATC CTTGGCCGTG GAGGGCATGG AACAGTATAC AAAGGTATCT
TATCTAACCA ACATGTGGTG GCTATTAAAA AGGCCAAAGT TATAAGGGAA TGCGAGATTA ATGATTTCAT CAACGAGGTT
TCGATTCTTT CTCAGATAAA TCACCGAAAT ATTGTTAAAC TCTTTGGATG CTGTCTTGAA ACTGAGGTCC CCTTATTAGT
CTATGATTTT ATTCCCAATG GTTCATTGTT CGGACTACTT CATCCAGATT CCAGTAGCAC AATCTATTTA TCATGGGGTG
ACTGCCTAAG GATTGCAGCA GAAGCAGCTG GAGCTCTATA TTATCTCCAC TCTGCAGCAT CAATTTCCAT CTTCCACCGT
GATGTGAAGT CATCTAATAT ACTCTTGGAT GCAAACTATA CTGCTAAAGT TTCAGATTTT GGTGCTTCAA GATCAGTTCC
CATCGATCAA ACCCATATCA TCACAAATGT ACAGGGTACA TTTGGTTACT TGGATCCAGA ATATTACCAA ACTAggcagc
taaatgagaa gagtgatgtc tatagttttg gtgtggtact cctagaactt CTTCTGAGAA AGCAACCCAT TTTTACAATA
AACTCTGGGA TGAAACAAAA TTTGTGTAGT TACTTCCTTT CAGAGATTAA AACCAGGCCA ATTACAGATA TGGTCGATGC
TCAAGTTCTC GAAGAAGCAA ATGAGGAAGA TATCAAAGAA GTTGCATCCC TTGCTGAGAT GTGCTTGAAG CTAAAAGGTG
AAGAAAGGCC CACGATGAAG AAAGTAGAGA TGACGTTACA GCTTCTGCGA ACAAAAACGA TGAACTCATC TCAAGTAGAT
CCAACCATTG ACCAAGAGAT TCAAACTGTT CTGACTGAAG GAGCCAGTGA CCCAGAGATA CAACCATTAG TAACAAATTT
GGATGTTGAT AGAGCTAATG CAGCATCTCA ACGCTTCCAA ATATCATGCT ATAGCTTGGA GCAAGAATTC TTGTCATCTG
CTAGCTTACC ACGGTAGATG TGTTTATCCT ATTTCTGATG TGTTTAGTTA ACTTGCATAT GTATTGTGTA CTTGCAGTCA
TGTATGTTGA AATGAGAAAT TATACTATAT GCCATC