Os10t0180800-02

Locus

Os10g0180800

Description

Similar to Calcium binding EGF domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WAK112

CGSNL Gene Name

WALL-ASSOCIATED KINASE GENE 112

Oryzabase Gene Symbol Synonym(s)

OsWAK112, OsWAK112d

Oryzabase Gene Name Synonym(s)

cell wall associated receptor kinase 112, cell wall associated receptor kinase 112d

Transcript Evidence

AK111809 (DDBJ, Best hit)

Protein Evidence

Q10A19 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

EGF-like calcium-binding (IPR001881)

Epidermal growth factor-like (IPR006210)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

EGF-like calcium-binding, conserved site (IPR018097)

Full-length cDNA

J013116E20 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0180800-02)

RiceXPro (AK111809)

Others

Oryzabase (8029)

KEGG (Os10t0180800-02)

Transcript

4747 bp

>Os10t0180800-02 Similar to Calcium binding EGF domain containing protein, expressed.
GCTTAGCTAGACATGCTTATGTTGTTACTAAACATACGTAGACAAGTCCAAACTTTATAC
TTGAGAGAATCGAGTATCTCTGTAGCAAGAGTTCAGATGGGCCACCTCAATATCATGTTA
GCTTTCCTTTCATTTGTGTTATTAGGGTTAGCTGAAGTCGAGGGAACTGTAGCACTGAGT
CAAATCCTCTCAAATAGCCATCTGATCACCCCGTACCGAGAGGTTACGGCAAGAAAGTTT
GAGAGAAGGTCCTTACTGCAGGATCATAGTAGTGATGATAGGAGATCATCTAATGCAAGC
CTTCCCTCTGCTGCCACACTTGCTAACTGTCCAAAGCGATGCGGCAACTTGAGCTTCGAC
TATCCCTTCGGCATAGGAGATGGTTGTTTCCGCCATCCCGATTTCAGTCTCACATGCAAC
GCCACTACTCAGCCTCCCAAACTCCTCTTGCATATTAACGAAAGCGTGGAGGTTATAGAT
AATATTGAGGTCGTCGGTAAGGATATAGCTGAGTTTTTCTACTTCAACTTCTTTATGGTC
GCATTTAACCATCTCATCCCCATAAAAGCTGGTGTCGATGTCTATAACCTTACATGGAAA
GCCCCAGGGATTTCTTTTACTATTTCAGAGATGATGATAATTACTGTCGTCAGCTGCGAC
TTGGATGTATTCTTGATAGGCCAAGACAACACTCCTAAACTGCTTTGCATGGTTGCTTGT
CCCAACAAAGAGATTGCAGACATGGTGTACATGCAAGACTGTGAAGGCCCTGGCTGTTGT
ACTGTATTATCTGAAACACCAGTTCAGGCTGTACAATTGCAGTTTGTTCGCCATGAGACA
AGTAATGCTGGAAAAATCTCCAATCTCAGCATGCTATGGGATAGAATCAACATAACTATT
GGGGCGCCACTTGTTTGGAGTATTGTTGACCAAACAAGATGCTCAAGAAACATGGAAGAT
AACTTCGCTTGTGTCAGCAACCACAGTGGGTGCATAACTTCTGTGTTTAGAGATATTGGC
TATGCCTGCCAATGCAATTCTGGCTACAAGGGAAATCCTTTTATCCTTGATGGTTGCAAG
CATGACAGCGGTAACTTTCTCCACCATACCTTAATTATCGTATTAATTTAAAAGATAAGG
ATAGCAATCCGGCCTCTATATCTACAGTAGTCAGTAGATATACCTTGTCGTCGTATTACA
TTTAAAAAAACAAAAGTCACTGTTTTAGTACTTTAAATATCCAAGCATTTGATTTTAGTA
CTGAAAGTCTGAAATCAACATGCACAATCATCTGATTTTGACCTGACATTTGGGAGTTGG
GACCGATTGTAATTTGTAACCCTTTCTCTTGTCTTCACCATGCTATTTGACGCAATGAAC
AGGATGAGGTAAGTAATATGCTGACGGAGCAATTGAATGTCATATTCAGGATCAAGTATA
TTCCTCTTTAATTCCAGGGAACTGACAAAAAAACGAATTATTCAGCAACCACACGAGTAA
GTTCTTGTCAGTTTCCACCCTAGGAAGATCAGCTCGGAATATTTTTAGCCACTTGACATT
TTTGTCAAAAAATTTGGGAACTTCTGGGATAATTGGGTTTGCAGATAGAATTTTCTCCCA
TAATTAGTGAATATATACTTCTGGGGCAAACATATTTTCCACTTTTTTTTCCTTCTACTA
GGATAAACAGTATATACTGGATTTTATTATTTCCATTTATTCATTTTGGAAATGAAAACA
TTATCTCTCTTTTACCGATACCATATTTTGTGGTCAACAATAGATGACTATACAGTACTT
TGATGTTCTCGTACAAAATGAAAATGCACTATTAATCCACTTTATCTATGCGTAAATACA
TGCATCACTCATTTTTACAAATACAACTAGGACATGTATGCGATcacatcctatgtacac
aagctttgcatgtaaacatcgtgcacaccaactaacaaatatcacagaaaaatctaaagt
attatatcccaatataaaatcttaacctcaaatttattatatttttacctaaaaataaaa
atttgataattttaaactcaaatttattatatctttttagatctaatttgaagataaaat
gtatccgtgcaattttatctataattttcggtgatatttgttgttagtgtgcacggtatg
tacacaggaaggcttatgtgtatacgatTATGTTTCCAACATGTATACCCTTTTACCAGA
AACAACGAGAACACTTGGAGATGGGGCATAACATGGAGTTTTTACTGATGCCAGGTTACA
ACCCTAGACCAGAAAAGCATAATTGCGCTCGACAATGTGGGACAATCACAGTCCCGTTTC
CGTTTGGCCTTGAAGAGGGTTGCTCCGCAAGGAAACGTTTTCAGCTCAACTGCTCCGACA
AGACAAATTCGGTCCTCAAGTTCAATGACTATTTTCAGGTGACGTATATAAATGTCAGTG
AAGGACTTCTGGGCATCAAACACAACTCATCGCTGGAGGAGCAACTATTCAATATAATGA
TGGAAATGATGACTTCTGATAATGAGCCAGACCTATTTGTTGACCCTCTTGAATCAGTCT
CTGTGCAATGGGCCGTTGCCAACCTGACATGCCAAGAGGCGCAACACAACACTTCTGGAT
ATGCATGTGTAAGTACCAGCAGCTCCTGCTTGAATGTCCTTAGCTCCATGGATGGTTATG
TTGGCTACAGATGCAGTTGCTTGCCTGGTTATCGTGGAAATCCATACATCCTAGATGGCT
GCGAAGGTAATTCACCAACTTCATCCCCCAAATTAAACATGATTGCTGCAAAGGTCACAT
TGAATTCAAATCTTTGATATTTAAACAACGAAAAACATCGACCATTATGGCCTAACAGAG
TCAACGATACCAATCACCAATGCTGAAACATCAAATTTCAAATGATGTTCGAGTGGCTGC
TCTTCCCTACTGTCATATTTTTATCCTGATCAGTAAATTTTATTAAATTAACTATTAAAT
AATCACAATTTCTCTTATTTTCTACAAATTGAACGATGTTCTTGCATACAAAGCAAAGAG
TTCCTCATGGAAATTATCTGACTATCAAACATACATAAGTCCCCAATGTTTTCTTAATAT
TTATCATTCTAGTGTGATAAAAAGAATCATGTGGCCAATATTTTATTTGGTACATAAATA
CAGTTTTTTGTTCAAAATTATATATTGCCTTACTGAGATGTGTTTACCGGTTACAGATAT
CGACGAGTGCCGAGAGACACCAGGAATTTGTAAAGGAGTTTGCAAGAATACCGTTGGAAA
CTACAGCTGCACCAAGTGCCCTGATCATACCGAGTACGATATTTTAAGAATGCAGTGTAC
TCCAATAAGAAAGAAAAGCTTCTACTTAGGTATTATAATTGGCCTTAGCAGTGGCTTTGG
AATGCTACTTCTTGGATTAAGTGGAATAGTTCTCATTCGAAGATGGAAAAGACATGCACA
GAAAAGACTGCAGACGAAGTATTTCCGAAAGAACCAGGGCCTTCTATTGGAACAATTGAT
ATCATCGGATGAAAATGCTAGTGAGAAGACAAAAATTTTCTCCTTAGAAGAGCTTAAAAA
GGCGACAAATAACTTTGATACCACACGTATCCTTGGCCGTGGAGGGCATGGAACAGTATA
CAAAGGTATCTTATCTAACCAACATGTGGTGGCTATTAAAAAGGCCAAAGTTATAAGGGA
ATGCGAGATTAATGATTTCATCAACGAGGTTTCGATTCTTTCTCAGATAAATCACCGAAA
TATTGTTAAACTCTTTGGATGCTGTCTTGAAACTGAGGTCCCCTTATTAGTCTATGATTT
TATTCCCAATGGTTCATTGTTCGGACTACTTCATCCAGATTCCAGTAGCACAATCTATTT
ATCATGGGGTGACTGCCTAAGGATTGCAGCAGAAGCAGCTGGAGCTCTATATTATCTCCA
CTCTGCAGCATCAATTTCCATCTTCCACCGTGATGTGAAGTCATCTAATATACTCTTGGA
TGCAAACTATACTGCTAAAGTTTCAGATTTTGGTGCTTCAAGATCAGTTCCCATCGATCA
AACCCATATCATCACAAATGTACAGGGTACATTTGGTTACTTGGATCCAGAATATTACCA
AACTAggcagctaaatgagaagagtgatgtctatagttttggtgtggtactcctagaact
tCTTCTGAGAAAGCAACCCATTTTTACAATAAACTCTGGGATGAAACAAAATTTGTGTAG
TTACTTCCTTTCAGAGATTAAAACCAGGCCAATTACAGATATGGTCGATGCTCAAGTTCT
CGAAGAAGCAAATGAGGAAGATATCAAAGAAGTTGCATCCCTTGCTGAGATGTGCTTGAA
GCTAAAAGGTGAAGAAAGGCCCACGATGAAGAAAGTAGAGATGACGTTACAGCTTCTGCG
AACAAAAACGATGAACTCATCTCAAGTAGATCCAACCATTGACCAAGAGATTCAAACTGT
TCTGACTGAAGGAGCCAGTGACCCAGAGATACAACCATTAGTAACAAATTTGGATGTTGA
TAGAGCTAATGCAGCATCTCAACGCTTCCAAATATCATGCTATAGCTTGGAGCAAGAATT
CTTGTCATCTGCTAGCTTACCACGGTAGATGTGTTTATCCTATTTCTGATGTGTTTAGTT
AACTTGCATATGTATTGTGTACTTGCAGTCATGTATGTTGAAATGAGAAATTATACTATA
TGCCATC

CDS

1500 bp

>Os10t0180800-02 Similar to Calcium binding EGF domain containing protein, expressed.
ATGTGGCCAATATTTTATTTGGTACATAAATACAGTTTTTTGTTCAAAATTATATATTGC
CTTACTGAGATGTGTTTACCGGTTACAGATATCGACGAGTGCCGAGAGACACCAGGAATT
TGTAAAGGAGTTTGCAAGAATACCGTTGGAAACTACAGCTGCACCAAGTGCCCTGATCAT
ACCGAGTACGATATTTTAAGAATGCAGTGTACTCCAATAAGAAAGAAAAGCTTCTACTTA
GGTATTATAATTGGCCTTAGCAGTGGCTTTGGAATGCTACTTCTTGGATTAAGTGGAATA
GTTCTCATTCGAAGATGGAAAAGACATGCACAGAAAAGACTGCAGACGAAGTATTTCCGA
AAGAACCAGGGCCTTCTATTGGAACAATTGATATCATCGGATGAAAATGCTAGTGAGAAG
ACAAAAATTTTCTCCTTAGAAGAGCTTAAAAAGGCGACAAATAACTTTGATACCACACGT
ATCCTTGGCCGTGGAGGGCATGGAACAGTATACAAAGGTATCTTATCTAACCAACATGTG
GTGGCTATTAAAAAGGCCAAAGTTATAAGGGAATGCGAGATTAATGATTTCATCAACGAG
GTTTCGATTCTTTCTCAGATAAATCACCGAAATATTGTTAAACTCTTTGGATGCTGTCTT
GAAACTGAGGTCCCCTTATTAGTCTATGATTTTATTCCCAATGGTTCATTGTTCGGACTA
CTTCATCCAGATTCCAGTAGCACAATCTATTTATCATGGGGTGACTGCCTAAGGATTGCA
GCAGAAGCAGCTGGAGCTCTATATTATCTCCACTCTGCAGCATCAATTTCCATCTTCCAC
CGTGATGTGAAGTCATCTAATATACTCTTGGATGCAAACTATACTGCTAAAGTTTCAGAT
TTTGGTGCTTCAAGATCAGTTCCCATCGATCAAACCCATATCATCACAAATGTACAGGGT
ACATTTGGTTACTTGGATCCAGAATATTACCAAACTAggcagctaaatgagaagagtgat
gtctatagttttggtgtggtactcctagaacttCTTCTGAGAAAGCAACCCATTTTTACA
ATAAACTCTGGGATGAAACAAAATTTGTGTAGTTACTTCCTTTCAGAGATTAAAACCAGG
CCAATTACAGATATGGTCGATGCTCAAGTTCTCGAAGAAGCAAATGAGGAAGATATCAAA
GAAGTTGCATCCCTTGCTGAGATGTGCTTGAAGCTAAAAGGTGAAGAAAGGCCCACGATG
AAGAAAGTAGAGATGACGTTACAGCTTCTGCGAACAAAAACGATGAACTCATCTCAAGTA
GATCCAACCATTGACCAAGAGATTCAAACTGTTCTGACTGAAGGAGCCAGTGACCCAGAG
ATACAACCATTAGTAACAAATTTGGATGTTGATAGAGCTAATGCAGCATCTCAACGCTTC
CAAATATCATGCTATAGCTTGGAGCAAGAATTCTTGTCATCTGCTAGCTTACCACGGTAG

Protein

500 aa

>Os10t0180800-02 Similar to Calcium binding EGF domain containing protein, expressed.
MWPIFYLVHKYSFLFKIIYCLTEMCLPVTDIDECRETPGICKGVCKNTVGNYSCTKCPDH
TEYDILRMQCTPIRKKSFYLGIIIGLSSGFGMLLLGLSGIVLIRRWKRHAQKRLQTKYFR
KNQGLLLEQLISSDENASEKTKIFSLEELKKATNNFDTTRILGRGGHGTVYKGILSNQHV
VAIKKAKVIRECEINDFINEVSILSQINHRNIVKLFGCCLETEVPLLVYDFIPNGSLFGL
LHPDSSSTIYLSWGDCLRIAAEAAGALYYLHSAASISIFHRDVKSSNILLDANYTAKVSD
FGASRSVPIDQTHIITNVQGTFGYLDPEYYQTRQLNEKSDVYSFGVVLLELLLRKQPIFT
INSGMKQNLCSYFLSEIKTRPITDMVDAQVLEEANEEDIKEVASLAEMCLKLKGEERPTM
KKVEMTLQLLRTKTMNSSQVDPTIDQEIQTVLTEGASDPEIQPLVTNLDVDRANAASQRF
QISCYSLEQEFLSSASLPR*

5'UTR

chr10:5541425..5544572 (- strand) : 3148 bp

CDS

chr10:5541184..5541424 (- strand) : 241 bp

chr10:5539842..5541100 (- strand) : 1259 bp

3'UTR

chr10:5539743..5539841 (- strand) : 99 bp

FASTA

>Os10t0180800-02 class=Sequence position=chr10:5539743..5544572 (- strand)
GCTTAGCTAG ACATGCTTAT GTTGTTACTA AACATACGTA GACAAGTCCA AACTTTATAC TTGAGAGAAT CGAGTATCTC
TGTAGCAAGA GTTCAGATGG GCCACCTCAA TATCATGTTA GCTTTCCTTT CATTTGTGTT ATTAGGGTTA GCTGAAGTCG
AGGGAACTGT AGCACTGAGT CAAATCCTCT CAAATAGCCA TCTGATCACC CCGTACCGAG AGGTTACGGC AAGAAAGTTT
GAGAGAAGGT CCTTACTGCA GGATCATAGT AGTGATGATA GGAGATCATC TAATGCAAGC CTTCCCTCTG CTGCCACACT
TGCTAACTGT CCAAAGCGAT GCGGCAACTT GAGCTTCGAC TATCCCTTCG GCATAGGAGA TGGTTGTTTC CGCCATCCCG
ATTTCAGTCT CACATGCAAC GCCACTACTC AGCCTCCCAA ACTCCTCTTG CATATTAACG AAAGCGTGGA GGTTATAGAT
AATATTGAGG TCGTCGGTAA GGATATAGCT GAGTTTTTCT ACTTCAACTT CTTTATGGTC GCATTTAACC ATCTCATCCC
CATAAAAGCT GGTGTCGATG TCTATAACCT TACATGGAAA GCCCCAGGGA TTTCTTTTAC TATTTCAGAG ATGATGATAA
TTACTGTCGT CAGCTGCGAC TTGGATGTAT TCTTGATAGG CCAAGACAAC ACTCCTAAAC TGCTTTGCAT GGTTGCTTGT
CCCAACAAAG AGATTGCAGA CATGGTGTAC ATGCAAGACT GTGAAGGCCC TGGCTGTTGT ACTGTATTAT CTGAAACACC
AGTTCAGGCT GTACAATTGC AGTTTGTTCG CCATGAGACA AGTAATGCTG GAAAAATCTC CAATCTCAGC ATGCTATGGG
ATAGAATCAA CATAACTATT GGGGCGCCAC TTGTTTGGAG TATTGTTGAC CAAACAAGAT GCTCAAGAAA CATGGAAGAT
AACTTCGCTT GTGTCAGCAA CCACAGTGGG TGCATAACTT CTGTGTTTAG AGATATTGGC TATGCCTGCC AATGCAATTC
TGGCTACAAG GGAAATCCTT TTATCCTTGA TGGTTGCAAG CATGACAGCG GTAACTTTCT CCACCATACC TTAATTATCG
TATTAATTTA AAAGATAAGG ATAGCAATCC GGCCTCTATA TCTACAGTAG TCAGTAGATA TACCTTGTCG TCGTATTACA
TTTAAAAAAA CAAAAGTCAC TGTTTTAGTA CTTTAAATAT CCAAGCATTT GATTTTAGTA CTGAAAGTCT GAAATCAACA
TGCACAATCA TCTGATTTTG ACCTGACATT TGGGAGTTGG GACCGATTGT AATTTGTAAC CCTTTCTCTT GTCTTCACCA
TGCTATTTGA CGCAATGAAC AGGATGAGGT AAGTAATATG CTGACGGAGC AATTGAATGT CATATTCAGG ATCAAGTATA
TTCCTCTTTA ATTCCAGGGA ACTGACAAAA AAACGAATTA TTCAGCAACC ACACGAGTAA GTTCTTGTCA GTTTCCACCC
TAGGAAGATC AGCTCGGAAT ATTTTTAGCC ACTTGACATT TTTGTCAAAA AATTTGGGAA CTTCTGGGAT AATTGGGTTT
GCAGATAGAA TTTTCTCCCA TAATTAGTGA ATATATACTT CTGGGGCAAA CATATTTTCC ACTTTTTTTT CCTTCTACTA
GGATAAACAG TATATACTGG ATTTTATTAT TTCCATTTAT TCATTTTGGA AATGAAAACA TTATCTCTCT TTTACCGATA
CCATATTTTG TGGTCAACAA TAGATGACTA TACAGTACTT TGATGTTCTC GTACAAAATG AAAATGCACT ATTAATCCAC
TTTATCTATG CGTAAATACA TGCATCACTC ATTTTTACAA ATACAACTAG GACATGTATG CGATcacatc ctatgtacac
aagctttgca tgtaaacatc gtgcacacca actaacaaat atcacagaaa aatctaaagt attatatccc aatataaaat
cttaacctca aatttattat atttttacct aaaaataaaa atttgataat tttaaactca aatttattat atctttttag
atctaatttg aagataaaat gtatccgtgc aattttatct ataattttcg gtgatatttg ttgttagtgt gcacggtatg
tacacaggaa ggcttatgtg tatacgatTA TGTTTCCAAC ATGTATACCC TTTTACCAGA AACAACGAGA ACACTTGGAG
ATGGGGCATA ACATGGAGTT TTTACTGATG CCAGGTTACA ACCCTAGACC AGAAAAGCAT AATTGCGCTC GACAATGTGG
GACAATCACA GTCCCGTTTC CGTTTGGCCT TGAAGAGGGT TGCTCCGCAA GGAAACGTTT TCAGCTCAAC TGCTCCGACA
AGACAAATTC GGTCCTCAAG TTCAATGACT ATTTTCAGGT GACGTATATA AATGTCAGTG AAGGACTTCT GGGCATCAAA
CACAACTCAT CGCTGGAGGA GCAACTATTC AATATAATGA TGGAAATGAT GACTTCTGAT AATGAGCCAG ACCTATTTGT
TGACCCTCTT GAATCAGTCT CTGTGCAATG GGCCGTTGCC AACCTGACAT GCCAAGAGGC GCAACACAAC ACTTCTGGAT
ATGCATGTGT AAGTACCAGC AGCTCCTGCT TGAATGTCCT TAGCTCCATG GATGGTTATG TTGGCTACAG ATGCAGTTGC
TTGCCTGGTT ATCGTGGAAA TCCATACATC CTAGATGGCT GCGAAGGTAA TTCACCAACT TCATCCCCCA AATTAAACAT
GATTGCTGCA AAGGTCACAT TGAATTCAAA TCTTTGATAT TTAAACAACG AAAAACATCG ACCATTATGG CCTAACAGAG
TCAACGATAC CAATCACCAA TGCTGAAACA TCAAATTTCA AATGATGTTC GAGTGGCTGC TCTTCCCTAC TGTCATATTT
TTATCCTGAT CAGTAAATTT TATTAAATTA ACTATTAAAT AATCACAATT TCTCTTATTT TCTACAAATT GAACGATGTT
CTTGCATACA AAGCAAAGAG TTCCTCATGG AAATTATCTG ACTATCAAAC ATACATAAGT CCCCAATGTT TTCTTAATAT
TTATCATTCT AGTGTGATAA AAAGAATCAT GTGGCCAATA TTTTATTTGG TACATAAATA CAGTTTTTTG TTCAAAATTA
TATATTGCCT TACTGAGATG TGTTTACCGG TTACAGATAT CGACGAGTGC CGAGAGACAC CAGGAATTTG TAAAGGAGTT
TGCAAGAATA CCGTTGGAAA CTACAGCTGC ACCAAGTGCC CTGATCATAC CGAGTACGAT ATTTTAAGAA TGCAGTGTAC
TCCAATAAGA AAGAAAAGCT TCTACTTAGG TGAGTCCTAA TGTCCTATAG TGATCAAACA ACACTGGTAG AGGGTGCATT
GATATATATC ATAGGGGATT TTATCATTGT AGGTATTATA ATTGGCCTTA GCAGTGGCTT TGGAATGCTA CTTCTTGGAT
TAAGTGGAAT AGTTCTCATT CGAAGATGGA AAAGACATGC ACAGAAAAGA CTGCAGACGA AGTATTTCCG AAAGAACCAG
GGCCTTCTAT TGGAACAATT GATATCATCG GATGAAAATG CTAGTGAGAA GACAAAAATT TTCTCCTTAG AAGAGCTTAA
AAAGGCGACA AATAACTTTG ATACCACACG TATCCTTGGC CGTGGAGGGC ATGGAACAGT ATACAAAGGT ATCTTATCTA
ACCAACATGT GGTGGCTATT AAAAAGGCCA AAGTTATAAG GGAATGCGAG ATTAATGATT TCATCAACGA GGTTTCGATT
CTTTCTCAGA TAAATCACCG AAATATTGTT AAACTCTTTG GATGCTGTCT TGAAACTGAG GTCCCCTTAT TAGTCTATGA
TTTTATTCCC AATGGTTCAT TGTTCGGACT ACTTCATCCA GATTCCAGTA GCACAATCTA TTTATCATGG GGTGACTGCC
TAAGGATTGC AGCAGAAGCA GCTGGAGCTC TATATTATCT CCACTCTGCA GCATCAATTT CCATCTTCCA CCGTGATGTG
AAGTCATCTA ATATACTCTT GGATGCAAAC TATACTGCTA AAGTTTCAGA TTTTGGTGCT TCAAGATCAG TTCCCATCGA
TCAAACCCAT ATCATCACAA ATGTACAGGG TACATTTGGT TACTTGGATC CAGAATATTA CCAAACTAgg cagctaaatg
agaagagtga tgtctatagt tttggtgtgg tactcctaga acttCTTCTG AGAAAGCAAC CCATTTTTAC AATAAACTCT
GGGATGAAAC AAAATTTGTG TAGTTACTTC CTTTCAGAGA TTAAAACCAG GCCAATTACA GATATGGTCG ATGCTCAAGT
TCTCGAAGAA GCAAATGAGG AAGATATCAA AGAAGTTGCA TCCCTTGCTG AGATGTGCTT GAAGCTAAAA GGTGAAGAAA
GGCCCACGAT GAAGAAAGTA GAGATGACGT TACAGCTTCT GCGAACAAAA ACGATGAACT CATCTCAAGT AGATCCAACC
ATTGACCAAG AGATTCAAAC TGTTCTGACT GAAGGAGCCA GTGACCCAGA GATACAACCA TTAGTAACAA ATTTGGATGT
TGATAGAGCT AATGCAGCAT CTCAACGCTT CCAAATATCA TGCTATAGCT TGGAGCAAGA ATTCTTGTCA TCTGCTAGCT
TACCACGGTA GATGTGTTTA TCCTATTTCT GATGTGTTTA GTTAACTTGC ATATGTATTG TGTACTTGCA GTCATGTATG
TTGAAATGAG AAATTATACT ATATGCCATC