Os10t0180800-03

Locus

Os10g0180800

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WAK112

CGSNL Gene Name

WALL-ASSOCIATED KINASE GENE 112

Oryzabase Gene Symbol Synonym(s)

OsWAK112, OsWAK112d

Oryzabase Gene Name Synonym(s)

cell wall associated receptor kinase 112, cell wall associated receptor kinase 112d

Transcript Evidence

AK111989 (DDBJ, Best hit)

Protein Evidence

Q33AH4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

EGF-like calcium-binding (IPR001881)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Epidermal growth factor-like (IPR006210)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

EGF-like calcium-binding, conserved site (IPR018097)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-032-C01 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0180800-03)

RiceXPro (AK111989)

Others

Oryzabase (8029)

KEGG (Os10t0180800-03)

Transcript

1978 bp

>Os10t0180800-03 Hypothetical conserved gene.
CATAATTGCGCTCGACAATGTGGGACAATCACAGTCCCGTTTCCGTTTGGCCTTGAAGAG
GGTTGCTCCGCAAGGAAACGTTTTCAGCTCAACTGCTCCGACAAGACAAATTCGGTCCTC
AAGTTCAATGACTATTTTCAGGTGACGTATATAAATGTCAGTGAAGGACTTCTGGGCATC
AAACACAACTCATCGCTGGAGGAGCAACTATTCAATATAATGATGGAAATGATGACTTCT
GATAATGAGCCAGACCTATTTGTTGACCCTCTTGAATCAGTCTCTGTGCAATGGGCCGTT
GCCAACCTGACATGCCAAGAGGCGCAACACAACACTTCTGGATATGCATGTGTAAGTACC
AGCAGCTCCTGCTTGAATGTCCTTAGCTCCATGGATGGTTATGTTGGCTACAGATGCAGT
TGCTTGCCTGGTTATCGTGGAAATCCATACATCCTAGATGGCTGCGAAGATATCGACGAG
TGCCGAGAGACACCAGGAATTTGTAAAGGAGTTTGCAAGAATACCGTTGGAAACTACAGC
TGCACCAAGTGCCCTGATCATACCGAGTACGATATTTTAAGAATGCAGTGTACTCCAATA
AGAAAGAAAAGCTTCTACTTAGGTATTATAATTGGCCTTAGCAGTGGCTTTGGAATGCTA
CTTCTTGGATTAAGTGGAATAGTTCTCATTCGAAGATGGAAAAGACATGCACAGAAAAGA
CTGCAGACGAAGTATTTCCGAAAGAACCAGGGCCTTCTATTGGAACAATTGATATCATCG
GATGAAAATGCTAGTGAGAAGACAAAAATTTTCTCCTTAGAAGAGCTTAAAAAGGCGACA
AATAACTTTGATACCACACGTATCCTTGGCCGTGGAGGGCATGGAACAGTATACAAAGGT
ATCTTATCTAACCAACATGTGGTGGCTATTAAAAAGGCCAAAGTTATAAGGGAATGCGAG
ATTAATGATTTCATCAACGAGGTTTCGATTCTTTCTCAGATAAATCACCGAAATATTGTT
AAACTCTTTGGATGCTGTCTTGAAACTGAGGTCCCCTTATTAGTCTATGATTTTATTCCC
AATGGTTCATTGTTCGGACTACTTCATCCAGATTCCAGTAGCACAATCTATTTATCATGG
GGTGACTGCCTAAGGATTGCAGCAGAAGCAGCTGGAGCTCTATATTATCTCCACTCTGCA
GCATCAATTTCCATCTTCCACCGTGATGTGAAGTCATCTAATATACTCTTGGATGCAAAC
TATACTGCTAAAGTTTCAGATTTTGGTGCTTCAAGATCAGTTCCCATCGATCAAACCCAT
ATCATCACAAATGTACAGGGTACATTTGGTTACTTGGATCCAGAATATTACCAAACTAgg
cagctaaatgagaagagtgatgtctatagttttggtgtggtactcctagaacttCTTCTG
AGAAAGCAACCCATTTTTACAATAAACTCTGGGATGAAACAAAATTTGTGTAGTTACTTC
CTTTCAGAGATTAAAACCAGGCCAATTACAGATATGGTCGATGCTCAAGTTCTCGAAGAA
GCAAATGAGGAAGATATCAAAGAAGTTGCATCCCTTGCTGAGATGTGCTTGAAGCTAAAA
GGTGAAGAAAGGCCCACGATGAAGAAAGTAGAGATGACGTTACAGCTTCTGCGAACAAAA
ACGATGAACTCATCTCAAGTAGATCCAACCATTGACCAAGAGATTCAAACTGTTCTGACT
GAAGGAGCCAGTGACCCAGAGATACAACCATTAGTAACAAATTTGGATGTTGATAGAGCT
AATGCAGCATCTCAACGCTTCCAAATATCATGCTATAGCTTGGAGCAAGAATTCTTGTCA
TCTGCTAGCTTACCACGGTAGATGTGTTTATCCTATTTCTGATGTGTTTAGTTAACTTGC
ATATGTATTGTGTACTTGCAGTCATGTATGTTGAAATGAGAAATTATACTATATGCCA

CDS

1881 bp

>Os10t0180800-03 Hypothetical conserved gene.
CATAATTGCGCTCGACAATGTGGGACAATCACAGTCCCGTTTCCGTTTGGCCTTGAAGAG
GGTTGCTCCGCAAGGAAACGTTTTCAGCTCAACTGCTCCGACAAGACAAATTCGGTCCTC
AAGTTCAATGACTATTTTCAGGTGACGTATATAAATGTCAGTGAAGGACTTCTGGGCATC
AAACACAACTCATCGCTGGAGGAGCAACTATTCAATATAATGATGGAAATGATGACTTCT
GATAATGAGCCAGACCTATTTGTTGACCCTCTTGAATCAGTCTCTGTGCAATGGGCCGTT
GCCAACCTGACATGCCAAGAGGCGCAACACAACACTTCTGGATATGCATGTGTAAGTACC
AGCAGCTCCTGCTTGAATGTCCTTAGCTCCATGGATGGTTATGTTGGCTACAGATGCAGT
TGCTTGCCTGGTTATCGTGGAAATCCATACATCCTAGATGGCTGCGAAGATATCGACGAG
TGCCGAGAGACACCAGGAATTTGTAAAGGAGTTTGCAAGAATACCGTTGGAAACTACAGC
TGCACCAAGTGCCCTGATCATACCGAGTACGATATTTTAAGAATGCAGTGTACTCCAATA
AGAAAGAAAAGCTTCTACTTAGGTATTATAATTGGCCTTAGCAGTGGCTTTGGAATGCTA
CTTCTTGGATTAAGTGGAATAGTTCTCATTCGAAGATGGAAAAGACATGCACAGAAAAGA
CTGCAGACGAAGTATTTCCGAAAGAACCAGGGCCTTCTATTGGAACAATTGATATCATCG
GATGAAAATGCTAGTGAGAAGACAAAAATTTTCTCCTTAGAAGAGCTTAAAAAGGCGACA
AATAACTTTGATACCACACGTATCCTTGGCCGTGGAGGGCATGGAACAGTATACAAAGGT
ATCTTATCTAACCAACATGTGGTGGCTATTAAAAAGGCCAAAGTTATAAGGGAATGCGAG
ATTAATGATTTCATCAACGAGGTTTCGATTCTTTCTCAGATAAATCACCGAAATATTGTT
AAACTCTTTGGATGCTGTCTTGAAACTGAGGTCCCCTTATTAGTCTATGATTTTATTCCC
AATGGTTCATTGTTCGGACTACTTCATCCAGATTCCAGTAGCACAATCTATTTATCATGG
GGTGACTGCCTAAGGATTGCAGCAGAAGCAGCTGGAGCTCTATATTATCTCCACTCTGCA
GCATCAATTTCCATCTTCCACCGTGATGTGAAGTCATCTAATATACTCTTGGATGCAAAC
TATACTGCTAAAGTTTCAGATTTTGGTGCTTCAAGATCAGTTCCCATCGATCAAACCCAT
ATCATCACAAATGTACAGGGTACATTTGGTTACTTGGATCCAGAATATTACCAAACTAgg
cagctaaatgagaagagtgatgtctatagttttggtgtggtactcctagaacttCTTCTG
AGAAAGCAACCCATTTTTACAATAAACTCTGGGATGAAACAAAATTTGTGTAGTTACTTC
CTTTCAGAGATTAAAACCAGGCCAATTACAGATATGGTCGATGCTCAAGTTCTCGAAGAA
GCAAATGAGGAAGATATCAAAGAAGTTGCATCCCTTGCTGAGATGTGCTTGAAGCTAAAA
GGTGAAGAAAGGCCCACGATGAAGAAAGTAGAGATGACGTTACAGCTTCTGCGAACAAAA
ACGATGAACTCATCTCAAGTAGATCCAACCATTGACCAAGAGATTCAAACTGTTCTGACT
GAAGGAGCCAGTGACCCAGAGATACAACCATTAGTAACAAATTTGGATGTTGATAGAGCT
AATGCAGCATCTCAACGCTTCCAAATATCATGCTATAGCTTGGAGCAAGAATTCTTGTCA
TCTGCTAGCTTACCACGGTAG

Protein

627 aa

>Os10t0180800-03 Hypothetical conserved gene.
HNCARQCGTITVPFPFGLEEGCSARKRFQLNCSDKTNSVLKFNDYFQVTYINVSEGLLGI
KHNSSLEEQLFNIMMEMMTSDNEPDLFVDPLESVSVQWAVANLTCQEAQHNTSGYACVST
SSSCLNVLSSMDGYVGYRCSCLPGYRGNPYILDGCEDIDECRETPGICKGVCKNTVGNYS
CTKCPDHTEYDILRMQCTPIRKKSFYLGIIIGLSSGFGMLLLGLSGIVLIRRWKRHAQKR
LQTKYFRKNQGLLLEQLISSDENASEKTKIFSLEELKKATNNFDTTRILGRGGHGTVYKG
ILSNQHVVAIKKAKVIRECEINDFINEVSILSQINHRNIVKLFGCCLETEVPLLVYDFIP
NGSLFGLLHPDSSSTIYLSWGDCLRIAAEAAGALYYLHSAASISIFHRDVKSSNILLDAN
YTAKVSDFGASRSVPIDQTHIITNVQGTFGYLDPEYYQTRQLNEKSDVYSFGVVLLELLL
RKQPIFTINSGMKQNLCSYFLSEIKTRPITDMVDAQVLEEANEEDIKEVASLAEMCLKLK
GEERPTMKKVEMTLQLLRTKTMNSSQVDPTIDQEIQTVLTEGASDPEIQPLVTNLDVDRA
NAASQRFQISCYSLEQEFLSSASLPR*

CDS

chr10:5541807..5542275 (- strand) : 469 bp

chr10:5541184..5541336 (- strand) : 153 bp

chr10:5539842..5541100 (- strand) : 1259 bp

3'UTR

chr10:5539745..5539841 (- strand) : 97 bp

FASTA

>Os10t0180800-03 class=Sequence position=chr10:5539745..5542275 (- strand)
CATAATTGCG CTCGACAATG TGGGACAATC ACAGTCCCGT TTCCGTTTGG CCTTGAAGAG GGTTGCTCCG CAAGGAAACG
TTTTCAGCTC AACTGCTCCG ACAAGACAAA TTCGGTCCTC AAGTTCAATG ACTATTTTCA GGTGACGTAT ATAAATGTCA
GTGAAGGACT TCTGGGCATC AAACACAACT CATCGCTGGA GGAGCAACTA TTCAATATAA TGATGGAAAT GATGACTTCT
GATAATGAGC CAGACCTATT TGTTGACCCT CTTGAATCAG TCTCTGTGCA ATGGGCCGTT GCCAACCTGA CATGCCAAGA
GGCGCAACAC AACACTTCTG GATATGCATG TGTAAGTACC AGCAGCTCCT GCTTGAATGT CCTTAGCTCC ATGGATGGTT
ATGTTGGCTA CAGATGCAGT TGCTTGCCTG GTTATCGTGG AAATCCATAC ATCCTAGATG GCTGCGAAGG TAATTCACCA
ACTTCATCCC CCAAATTAAA CATGATTGCT GCAAAGGTCA CATTGAATTC AAATCTTTGA TATTTAAACA ACGAAAAACA
TCGACCATTA TGGCCTAACA GAGTCAACGA TACCAATCAC CAATGCTGAA ACATCAAATT TCAAATGATG TTCGAGTGGC
TGCTCTTCCC TACTGTCATA TTTTTATCCT GATCAGTAAA TTTTATTAAA TTAACTATTA AATAATCACA ATTTCTCTTA
TTTTCTACAA ATTGAACGAT GTTCTTGCAT ACAAAGCAAA GAGTTCCTCA TGGAAATTAT CTGACTATCA AACATACATA
AGTCCCCAAT GTTTTCTTAA TATTTATCAT TCTAGTGTGA TAAAAAGAAT CATGTGGCCA ATATTTTATT TGGTACATAA
ATACAGTTTT TTGTTCAAAA TTATATATTG CCTTACTGAG ATGTGTTTAC CGGTTACAGA TATCGACGAG TGCCGAGAGA
CACCAGGAAT TTGTAAAGGA GTTTGCAAGA ATACCGTTGG AAACTACAGC TGCACCAAGT GCCCTGATCA TACCGAGTAC
GATATTTTAA GAATGCAGTG TACTCCAATA AGAAAGAAAA GCTTCTACTT AGGTGAGTCC TAATGTCCTA TAGTGATCAA
ACAACACTGG TAGAGGGTGC ATTGATATAT ATCATAGGGG ATTTTATCAT TGTAGGTATT ATAATTGGCC TTAGCAGTGG
CTTTGGAATG CTACTTCTTG GATTAAGTGG AATAGTTCTC ATTCGAAGAT GGAAAAGACA TGCACAGAAA AGACTGCAGA
CGAAGTATTT CCGAAAGAAC CAGGGCCTTC TATTGGAACA ATTGATATCA TCGGATGAAA ATGCTAGTGA GAAGACAAAA
ATTTTCTCCT TAGAAGAGCT TAAAAAGGCG ACAAATAACT TTGATACCAC ACGTATCCTT GGCCGTGGAG GGCATGGAAC
AGTATACAAA GGTATCTTAT CTAACCAACA TGTGGTGGCT ATTAAAAAGG CCAAAGTTAT AAGGGAATGC GAGATTAATG
ATTTCATCAA CGAGGTTTCG ATTCTTTCTC AGATAAATCA CCGAAATATT GTTAAACTCT TTGGATGCTG TCTTGAAACT
GAGGTCCCCT TATTAGTCTA TGATTTTATT CCCAATGGTT CATTGTTCGG ACTACTTCAT CCAGATTCCA GTAGCACAAT
CTATTTATCA TGGGGTGACT GCCTAAGGAT TGCAGCAGAA GCAGCTGGAG CTCTATATTA TCTCCACTCT GCAGCATCAA
TTTCCATCTT CCACCGTGAT GTGAAGTCAT CTAATATACT CTTGGATGCA AACTATACTG CTAAAGTTTC AGATTTTGGT
GCTTCAAGAT CAGTTCCCAT CGATCAAACC CATATCATCA CAAATGTACA GGGTACATTT GGTTACTTGG ATCCAGAATA
TTACCAAACT Aggcagctaa atgagaagag tgatgtctat agttttggtg tggtactcct agaacttCTT CTGAGAAAGC
AACCCATTTT TACAATAAAC TCTGGGATGA AACAAAATTT GTGTAGTTAC TTCCTTTCAG AGATTAAAAC CAGGCCAATT
ACAGATATGG TCGATGCTCA AGTTCTCGAA GAAGCAAATG AGGAAGATAT CAAAGAAGTT GCATCCCTTG CTGAGATGTG
CTTGAAGCTA AAAGGTGAAG AAAGGCCCAC GATGAAGAAA GTAGAGATGA CGTTACAGCT TCTGCGAACA AAAACGATGA
ACTCATCTCA AGTAGATCCA ACCATTGACC AAGAGATTCA AACTGTTCTG ACTGAAGGAG CCAGTGACCC AGAGATACAA
CCATTAGTAA CAAATTTGGA TGTTGATAGA GCTAATGCAG CATCTCAACG CTTCCAAATA TCATGCTATA GCTTGGAGCA
AGAATTCTTG TCATCTGCTA GCTTACCACG GTAGATGTGT TTATCCTATT TCTGATGTGT TTAGTTAACT TGCATATGTA
TTGTGTACTT GCAGTCATGT ATGTTGAAAT GAGAAATTAT ACTATATGCC A