Os10t0190000-01

Locus

Os10g0190000

Description

Similar to Ubiquitin-conjugating enzyme E2 M (EC 6.3.2.19) (Ubiquitin-protein ligase M) (Ubiquitin carrier protein M) (Nedd8-conjugating enzyme Ubc12).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC4

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 4

Oryzabase Gene Symbol Synonym(s)

OsUBC4

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 4

Transcript Evidence

AK064839 (DDBJ, Best hit)

Protein Evidence

Q7G4N6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J013000F24 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0190000-01)

RiceXPro (AK064839)

Others

Oryzabase (19552)

KEGG (Os10t0190000-01 (EC:6.3.2.19))

Transcript

2812 bp

>Os10t0190000-01 Similar to Ubiquitin-conjugating enzyme E2 M (EC 6.3.2.19) (Ubiquitin-protein ligase M) (Ubiquitin carrier protein M) (Nedd8-conjugating enzyme Ubc12).
cctagttccttcccttgcgtaatagaaagagagatctcccgtctcgtccgtcgtctcctc
cgctccttgcgccaagacgagtcgcggctcaacagaggaggggcgccgatctccatctgg
cgagcagagcaggggaggggaagggaaggtatcctgAAAGATGCTTAATCTTATCAAAAT
AAAGGATAAAAAGAAAGAGCAGGCAGCAAGTGCTGCTGGAAAGGCTCCTGTGAAGAAGCA
ATCTGCTGGAGAGCTCCGTCTTCACAAAGGTGCATTGAGTTATAGATGACTGTCAGCACT
TCCTTTTGGTCATAAAAACATGTTGTCTGGACATTGACAGAGCCTTCACAGTGCAATCTT
TATCTCTAATTTATTTTGTAATGTAATTTAAAATACGATAAATTACAATATTATGAAGAT
AATTTTGATACTAATCTACAATTCTGTATATATATGATTATTATGTATCTGATATTAATA
TTTATTTTTTTTGTTATTTTAACTAGATGTGTGTCTAAAATGAATGTGTTCTTGTGACCA
AAGTAATTACCTTTGTTGAGTTCTCTTACAAAAATTTGTGAGCTAGACATACAATTCCTT
GAATTTTAAACTTTTAACTAACTCTCAAAGCTTATCAAACTGTTCTCATAAATGTAATGT
TTCCACTATCCTCACAGGTGGTTTTTATTTGAATAATTTGATGCTGGCATGCTGCTGCAT
ATGTGGCTATGCTCTTTTTTAAGTTGTTAGCAATCTCTTTATTTTCATGTTGAGCATGAC
TAGTAGTATATGCGTCATGTGGGGCAGTCCTGCCGGCTGCCGGTGTCACCAAAGGGGACC
TGATAGTGCTCCAGCACACATGCCAGATGTGGAACAGTAGCTCTCTCATCTTCTCTTTCC
TTCATTTCTCTCCTTATTTCCTCTCTTTCTTGAATCCTGATCTAGAGGAGATGGAGCAGC
GAGGGTAGGAGCAGCACTGGGTTAATCAGTAGGAGAAGTGACAAAGAAGATGATAGCAGG
GATGTCAATTAATACTTACAGTTGCTATTCCTCATCGTGTGAAAGGAAATTAAAGTGACA
GGTGGATGGCTATTCCAATCATCCAATGCAGCGTATATTAATTTGTGGCACTTTAAGCTA
GGTGTATGGTATCTTATTTAAGTAATGCATTCCGTACACTGGCATGCTGTCTAGATGCCA
TGGAATATGTGAAAGCAACTCTTCTAGCGATTGTGCAAATGGCCAAACCTTGAATTTGTG
GACCATCCAAGTTGGAGTGCCTTAAAAGATTTTGCTTGAGGCCAAGAGCTATATGCTTGC
ACGGACTAAGCCACAAGTCCATGCGTGAATATATTAGTGAGCTAAACCTACCCAAGAGCA
CATCAATTTCTTTTCCCAATGGCAAGGATGATCTGATGAATTTTGAGATCATCGTCCGAC
CTGATGAAGGATATTACCTAGGTGGCACTTTCGTCTTTACTTTTCAAGTCTCTCCCTCTT
ATCCTCATGAACCTCCAAAGGTGAAGTGCAAGACCAAGGTATACCATCCAAATATTGATT
TGGAAGGAAATGTATGCCTGAACATTTTGCGTGAAGATTGGAAGCCTGTTCTCAACATCA
ACACTGTTATTTATGGCCTTAACCTTCTTTTTACGCAACCAAACGATGAGGATCCGTTGA
ACCATGAAGCAGCAGCTGTCCTCCGTGACAACCCAAAGCTGTTTGAAGCTAATGTTAAAA
GGGCAATGGCCGGAGGCTATGTGGGTCAACACTATTTCCCAAGATGTGCATGATATGGTG
CTGGGTGCCACAAACATTAGTAAGTTAAGCCACCTGGGCCTCTTCCCGACATTCTGGATT
GTATGGTTTCGGTGCGTTAAAGTGCTGTCGGATGGATGTGATATGTTGACTGTATGACGG
CGATGCTGCCATCTGTGTGATATTTGTTTAAAGTCAGTAAATTGGTAATCTGGTGGTGGT
ACAGATAAAATTTGAGTTGCAGTTCAAGCTGGATTTATACATCATTTTCTTTTGTGCAGT
TTGCTTCAGTCAGAACCTGATATCCATCTTTGCTCGTAGATAGTGCTGTGTATGTTTTCC
TTCCTGTATGGCTGTATGAGGCTTGAATTCGGTCCAACTATCAGATTGTAGTTTACGACT
TGTCTACATAACTCTCAAAATCTCCAATCGACTTGTCTACATAACACACAAGGCACATGT
TTATAGGAGGATCAGAGATTAAGGGTTATTAATAAGAGCACCATTCGAAAATTTCATTTT
TTTTTGTCACTATAGGTGAATACCAGTCTTTTGACATCCCACGAAAAATTTGGATCATAA
GGATTGAGTTACAAAGGCAAAGGCGAATCTTCTGCAAAAGTTAAACGTGCTGAAGTCCAC
AAGTCTTGTGTGGCAAGGGGAATCGCGTAAATTCACGTTCGAGGGACGTGGTTCGTTGCG
TCGCCGTCGCTTCCTCATCCGACGGCGCAATTTCCTGTGTGCGCGCGTTGTTTGTTGGGG
GTGGCCGGGTGGGGTATAACATCTCACCGTGATCGCCTCCGTTGCCGACTACAGCCCGCA
GCTGCTTAAAGTAACTGGGCCGAACCGAACCGTTGGACATCTCGTTTTTTATTTGGTATT
TTTATTCTCTTCAGCCTATGTTAGCTACATTTTTATTGAGAATTGAGCCAATTATTTTGT
AATAAGTAGTTATTATAGCTCTTTAAAGCAAAAACCGAACATGTATACTATTGACTAAAT
AACAATAACGGTGGTGATGGTTCTGCCACCAATCCACCACCACTTCTTTCAC

CDS

453 bp

>Os10t0190000-01 Similar to Ubiquitin-conjugating enzyme E2 M (EC 6.3.2.19) (Ubiquitin-protein ligase M) (Ubiquitin carrier protein M) (Nedd8-conjugating enzyme Ubc12).
ATGCGTGAATATATTAGTGAGCTAAACCTACCCAAGAGCACATCAATTTCTTTTCCCAAT
GGCAAGGATGATCTGATGAATTTTGAGATCATCGTCCGACCTGATGAAGGATATTACCTA
GGTGGCACTTTCGTCTTTACTTTTCAAGTCTCTCCCTCTTATCCTCATGAACCTCCAAAG
GTGAAGTGCAAGACCAAGGTATACCATCCAAATATTGATTTGGAAGGAAATGTATGCCTG
AACATTTTGCGTGAAGATTGGAAGCCTGTTCTCAACATCAACACTGTTATTTATGGCCTT
AACCTTCTTTTTACGCAACCAAACGATGAGGATCCGTTGAACCATGAAGCAGCAGCTGTC
CTCCGTGACAACCCAAAGCTGTTTGAAGCTAATGTTAAAAGGGCAATGGCCGGAGGCTAT
GTGGGTCAACACTATTTCCCAAGATGTGCATGA

Protein

151 aa

>Os10t0190000-01 Similar to Ubiquitin-conjugating enzyme E2 M (EC 6.3.2.19) (Ubiquitin-protein ligase M) (Ubiquitin carrier protein M) (Nedd8-conjugating enzyme Ubc12).
MREYISELNLPKSTSISFPNGKDDLMNFEIIVRPDEGYYLGGTFVFTFQVSPSYPHEPPK
VKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLNLLFTQPNDEDPLNHEAAAV
LRDNPKLFEANVKRAMAGGYVGQHYFPRCA*

5'UTR

chr10:6244562..6244717 (+ strand) : 156 bp

chr10:6245974..6247157 (+ strand) : 1184 bp

CDS

chr10:6247158..6247167 (+ strand) : 10 bp

chr10:6247639..6247747 (+ strand) : 109 bp

chr10:6248263..6248341 (+ strand) : 79 bp

chr10:6248430..6248546 (+ strand) : 117 bp

chr10:6249684..6249821 (+ strand) : 138 bp

3'UTR

chr10:6249822..6250840 (+ strand) : 1019 bp

FASTA

>Os10t0190000-01 class=Sequence position=chr10:6244562..6250840 (+ strand)
cctagttcct tcccttgcgt aatagaaaga gagatctccc gtctcgtccg tcgtctcctc cgctccttgc gccaagacga
gtcgcggctc aacagaggag gggcgccgat ctccatctgg cgagcagagc aggggagggg aagggaaggt atcctggtga
gcatcaacat cctcttcctg attcatctct ctctcccacc gggactactt atgtcttgga atttgcttgc gttcgttcgt
taaccctagc ttctcttcta gatctggaag aagctcttct cttaatttca gagccttaat cttaatacaa gtaatagttt
gtttgttccc ccaaaagttt aggggttcaa ctgtcccaac tcccaagttg gatccgcccc tgCCTGTGTA GAGCTCATCT
CCCTTAGCGT CGCCTATGAT TCTGAGAGTT TCACCCCAAC AGCCGTGTTG ATGAGCTTTG TAACGACCTG TTTTTCTCCT
GCTCTTGATA AAATTAGGCC AGCCTGATTT AAGAAAAGAA GTAAACATTC TAGCTTTAAT TTCCCGCTCG ATTCGCATGG
GGTTAGATTA ATGTTTCTTC TCGAGTATGT ATTGAGAAAC CAAATCGTGC ATGTGTTTAT TTCTGGAAGG AGAAGTGCTA
TAAATGTCTG TAATGTAGAA GCATTTTGTA AATGCATGTG CATTGAGTTC TTTTTATTCG TATCTCGAGA GTTTGTACAA
TAAGATGATT GTTCTGCACA CACCAAAAAA TGGTGCAGCT GCAAACACCT TGTGGTTGTG CCTTCCTAAA TACTACAGAA
ACATTAATGA GTCTAGTGTA GATGGCCAAA TGAAGCACAC TATTGTTATG GCATTACGGT AAGGGCCAGG AGGTATATGC
TTTCAACCGT GTTGTGTCTG GTCCCAATGT TCTTAAGTTA CAACCCAGGT GGAACAAATA AGAAACAGGG CGTCCGGATT
GGTTAGCTTG GTAATCAGAT TACACCAAAA AAAACCTGAA CCAAATGCCT CCTAAGTTTA GCCGAGCTAC TTAGTTACTG
GTTGCTGCTT AGTGTATTAG TATTATATTT AAATTTTGGA TCTTCCTGTT GTCAAAACTC ATCAAGTATT GTTTCTCCAG
TCCCCTCTCA AGAAATCCTT TCTGGGCAGT TGAAGGTCGT GTTGAATTTC CTTTTTGTGT TTTATTCATG TTTTATGCTG
TAATGGAAAT AACAAAACAG AGTGATGACT GATGTAGAGC AGACTTCTAG TCCTAACCAT TCCATTTTTT TGTGATTAAG
TTCTAACCAT TCGACTAAAA TAAACTACAC ATCAGAGATG CAGAAATGCA ACTAATTATG TTCTCTTTTG TGCTTTCATC
AGGTGATAGT GTTTTTTCTC TGATTGTAAA TCTTTTCCCC TTTTCTTTGC AGAAAGATGC TTAATCTTAT CAAAATAAAG
GATAAAAAGA AAGAGCAGGC AGCAAGTGCT GCTGGAAAGG CTCCTGTGAA GAAGCAATCT GCTGGAGAGC TCCGTCTTCA
CAAAGGTGCA TTGAGTTATA GATGACTGTC AGCACTTCCT TTTGGTCATA AAAACATGTT GTCTGGACAT TGACAGAGCC
TTCACAGTGC AATCTTTATC TCTAATTTAT TTTGTAATGT AATTTAAAAT ACGATAAATT ACAATATTAT GAAGATAATT
TTGATACTAA TCTACAATTC TGTATATATA TGATTATTAT GTATCTGATA TTAATATTTA TTTTTTTTGT TATTTTAACT
AGATGTGTGT CTAAAATGAA TGTGTTCTTG TGACCAAAGT AATTACCTTT GTTGAGTTCT CTTACAAAAA TTTGTGAGCT
AGACATACAA TTCCTTGAAT TTTAAACTTT TAACTAACTC TCAAAGCTTA TCAAACTGTT CTCATAAATG TAATGTTTCC
ACTATCCTCA CAGGTGGTTT TTATTTGAAT AATTTGATGC TGGCATGCTG CTGCATATGT GGCTATGCTC TTTTTTAAGT
TGTTAGCAAT CTCTTTATTT TCATGTTGAG CATGACTAGT AGTATATGCG TCATGTGGGG CAGTCCTGCC GGCTGCCGGT
GTCACCAAAG GGGACCTGAT AGTGCTCCAG CACACATGCC AGATGTGGAA CAGTAGCTCT CTCATCTTCT CTTTCCTTCA
TTTCTCTCCT TATTTCCTCT CTTTCTTGAA TCCTGATCTA GAGGAGATGG AGCAGCGAGG GTAGGAGCAG CACTGGGTTA
ATCAGTAGGA GAAGTGACAA AGAAGATGAT AGCAGGGATG TCAATTAATA CTTACAGTTG CTATTCCTCA TCGTGTGAAA
GGAAATTAAA GTGACAGGTG GATGGCTATT CCAATCATCC AATGCAGCGT ATATTAATTT GTGGCACTTT AAGCTAGGTG
TATGGTATCT TATTTAAGTA ATGCATTCCG TACACTGGCA TGCTGTCTAG ATGCCATGGA ATATGTGAAA GCAACTCTTC
TAGCGATTGT GCAAATGGCC AAACCTTGAA TTTGTGGACC ATCCAAGTTG GAGTGCCTTA AAAGATTTTG CTTGAGGCCA
AGAGCTATAT GCTTGCACGG ACTAAGCCAC AAGTCCATGC GTGAATGTGA GTATCTGTTG TTTGTATGTG ACCTACTGGG
GCTAAATTTG GAATTTTCAA TTTCTCTTTT TTTGGTGGTT AAAGAAGTTA ATTTCAATTT CTATCATTCG TCCAAATTAT
TGAGTTTTGA TACAAAtact ccctttgttc cacattgcaa gtcattttag ttttgtccca agtcaaaact tctttaactt
tgactaagtt catagaaaaa tgcaccagta tcgaaaataa caaataaatg cactgtcatg gtggttttaa tgaaactaat
ttgatattgt agatgttggt gcattttttc taggaatttg gtcaaagtta gagaattttg acttgggaca aaattaaaat
gacttacaat atggaacaga gggagtaGAT TTTCATATTT TTTATTATCA TAAACTTCTC CTTGTTACAA CTTTATCATG
TCATAAATTA TTTATGACTT TATATGATAT TGGGCAGATA TTAGTGAGCT AAACCTACCC AAGAGCACAT CAATTTCTTT
TCCCAATGGC AAGGATGATC TGATGAATTT TGAGATCATC GTCCGACCTG ATGAAGGATA TTACCTGTAA GTAGAATGCA
TCTCTGTTTT GTGTTTATTA TGTTGTTCTG CACTACCTCA CAAGTTTATG TCAATTTAAA GAACCTTCAC TATTTTTAAA
AGATCATTTA TGTCGTGTTA AAAAAAAGCA TTTACCAGTT CTTTCAGAAT TATTTATGGC AAAACAGGGG GTTATTTAAG
GCAGAATTAT TTACCTGTCT GTTGCCTAGT TAATAGGCAT GCGGCATGCC ACTACTTAAT GCGGATACTC CATCCTTGTT
TGCCTTAACA TAATCACATT TTGACTACTG AGTTTTGTAA GCTTTCGAAG GCAGTCATCT AGCACCTTCC AGCCTTGCTG
ATTTGTTCAC ATAGATGACT GACTATCCTT ATTTAGACTC GCCTGATTTG TTATAAGGTC CTAGGCTCTG ATGAGCTGCG
ACTAGCACTT GTGAACACTG TTTTTTCTTT TTGCTTAAAT GTCAATTCTA CATACCATGT TCCCACCTAT AATTCTATTT
ACAATGATTT TTCCTTTTTA GAGGTGGCAC TTTCGTCTTT ACTTTTCAAG TCTCTCCCTC TTATCCTCAT GAACCTCCAA
AGGTGAAGTG CAAGACCAAG GTATAAGATG GGGCTTTCTA TGCTATATAT TTTCCCAGTG AATATGTTGC CTCTTAACCA
ATTTCTATGC ATTATAACTT GCATTCAGGT ATACCATCCA AATATTGATT TGGAAGGAAA TGTATGCCTG AACATTTTGC
GTGAAGATTG GAAGCCTGTT CTCAACATCA ACACTGTTAT TTATGGCCTT AACCTTCTTT TTACGGTATT TCAGTTTCCT
TGACCCCTAT TGATTGCAAT TATGTATTTC GGAAATAGAT AAAAAAAACA AATATCTAAT CATGTTTACA ATGCTGTTCA
AACCTATCAT ATCATTATGC TTCGTTGTTT ACGAGATAAG GCCTTATGTT TACGATGCTG TTGTCATCTA CATTGTGCTT
CATGGTGTTT GTGATACTCG TTTTCTACTT TAAGCAGCAA TGTGGTAATC TTATCAATTT GAGAAAGGCA TGCATAATTC
ATGGTGTCCT ATTTTTGATG TACTTTAAGA TTGAATTCAA TTCTCGATGT ATAGTCTTGG TACAGAAGTA AAAAACTTAT
GCAAAGGTTT GTATAAAGAA CTATGATATA TTTTTACTTA TTTACTATGT ACAGGAGTAT TAGTTAAATA GTTATAGTTG
ACATGAGTTC TCCATTATCT TGAATTAAAT GTACATAAAA AATTTGAGTA GTTTCTAAGT CACGGATAAG TAAAATTAGG
CAGCCTAAAT TTCTATGGAA GACGGAAGTT GATATACTTA TATGTAGTTT CTGAGTCATT GCAACCATGA TTTGTGTGGG
TGATATGTTA GAGCTGTTTG GGCTGAGGTC TTTGGATGCC AATTTCTTAT CTTTAGTTAT AATTTCCATA CTGTTTTGTT
TGTAACTACA ATGTGGCCAA AACTTAGGTG AAAAATTACC AAAATTTGTC AGTGTAGTGT GTTATTTCTT TGGCACGAAA
AAAACAGGCC AAAGCTAAGC CCCAAGGCGC TTATTTGTTG ACACCCACTT CATTTTGTTT GGTTTTGAGT ATGGATGCTG
GACTAGTAAC ATCAATCACA ACTGGCATAG TAAAACTACT AAGAGGAAAA ATTGCTCCCC TGAACCTTGT CATTGAGGAT
GACACCTTGG AGAAACCCTT GTTCTGTAAC TTCTGTTGGC CAAACATCTC AACGAAAGTG CCGGGTAGCA TGAATGATTT
TTTTTTCCTT GAGATTCTTG TTGGATGATC AGATTATACA TTGCTTCCAT TCCTTGAGAT TCTTGTTGGA TGATCAGATT
ATACATTGCT TCCATTGCCA TTGGTGGGTT ACAGTTTAGT AAGATTTCTT GTGGCTTAGT TTGCTTTTGA TTTTGTCCGC
AGCAACCAAA CGATGAGGAT CCGTTGAACC ATGAAGCAGC AGCTGTCCTC CGTGACAACC CAAAGCTGTT TGAAGCTAAT
GTTAAAAGGG CAATGGCCGG AGGCTATGTG GGTCAACACT ATTTCCCAAG ATGTGCATGA TATGGTGCTG GGTGCCACAA
ACATTAGTAA GTTAAGCCAC CTGGGCCTCT TCCCGACATT CTGGATTGTA TGGTTTCGGT GCGTTAAAGT GCTGTCGGAT
GGATGTGATA TGTTGACTGT ATGACGGCGA TGCTGCCATC TGTGTGATAT TTGTTTAAAG TCAGTAAATT GGTAATCTGG
TGGTGGTACA GATAAAATTT GAGTTGCAGT TCAAGCTGGA TTTATACATC ATTTTCTTTT GTGCAGTTTG CTTCAGTCAG
AACCTGATAT CCATCTTTGC TCGTAGATAG TGCTGTGTAT GTTTTCCTTC CTGTATGGCT GTATGAGGCT TGAATTCGGT
CCAACTATCA GATTGTAGTT TACGACTTGT CTACATAACT CTCAAAATCT CCAATCGACT TGTCTACATA ACACACAAGG
CACATGTTTA TAGGAGGATC AGAGATTAAG GGTTATTAAT AAGAGCACCA TTCGAAAATT TCATTTTTTT TTGTCACTAT
AGGTGAATAC CAGTCTTTTG ACATCCCACG AAAAATTTGG ATCATAAGGA TTGAGTTACA AAGGCAAAGG CGAATCTTCT
GCAAAAGTTA AACGTGCTGA AGTCCACAAG TCTTGTGTGG CAAGGGGAAT CGCGTAAATT CACGTTCGAG GGACGTGGTT
CGTTGCGTCG CCGTCGCTTC CTCATCCGAC GGCGCAATTT CCTGTGTGCG CGCGTTGTTT GTTGGGGGTG GCCGGGTGGG
GTATAACATC TCACCGTGAT CGCCTCCGTT GCCGACTACA GCCCGCAGCT GCTTAAAGTA ACTGGGCCGA ACCGAACCGT
TGGACATCTC GTTTTTTATT TGGTATTTTT ATTCTCTTCA GCCTATGTTA GCTACATTTT TATTGAGAAT TGAGCCAATT
ATTTTGTAAT AAGTAGTTAT TATAGCTCTT TAAAGCAAAA ACCGAACATG TATACTATTG ACTAAATAAC AATAACGGTG
GTGATGGTTC TGCCACCAAT CCACCACCAC TTCTTTCAC

Locus: Os10g0190000

Loading...

Locus: Os10g0190000

Loading...