Os10t0190000-02

Locus

Os10g0190000

Description

Similar to Ubiquitin carrier protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC4

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 4

Oryzabase Gene Symbol Synonym(s)

OsUBC4

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 4

Transcript Evidence

AK066484 (DDBJ, Best hit)

Protein Evidence

Q53QR2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Full-length cDNA

J013070C18 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0190000-02)

RiceXPro (AK066484)

Others

Oryzabase (19552)

KEGG (Os10t0190000-02 (EC:6.3.2.19))

Transcript

940 bp

>Os10t0190000-02 Similar to Ubiquitin carrier protein.
gcgtaatagaaagagagatctcccgtctcgtccgtcgtctcctccgctccttgcgccaag
acgagtcgcggctcaacagaggaggggcgccgatctccatctggcgagcagagcagggga
ggggaagggaaggtatcctgAAAGATGCTTAATCTTATCAAAATAAAGGATAAAAAGAAA
GAGCAGGCAGCAAGTGCTGCTGGAAAGGCTCCTGTGAAGAAGCAATCTGCTGGAGAGCTC
CGTCTTCACAAAGATATTAGTGAGCTAAACCTACCCAAGAGCACATCAATTTCTTTTCCC
AATGGCAAGGATGATCTGATGAATTTTGAGATCATCGTCCGACCTGATGAAGGATATTAC
CTAGGTGGCACTTTCGTCTTTACTTTTCAAGTCTCTCCCTCTTATCCTCATGAACCTCCA
AAGGTGAAGTGCAAGACCAAGGTATACCATCCAAATATTGATTTGGAAGGAAATGTATGC
CTGAACATTTTGCGTGAAGATTGGAAGCCTGTTCTCAACATCAACACTGTTATTTATGGC
CTTAACCTTCTTTTTACGCAACCAAACGATGAGGATCCGTTGAACCATGAAGCAGCAGCT
GTCCTCCGTGACAACCCAAAGCTGTTTGAAGCTAATGTTAAAAGGGCAATGGCCGGAGGC
TATGTGGGTCAACACTATTTCCCAAGATGTGCATGATATGGTGCTGGGTGCCACAAACAT
TAGTAAGTTAAGCCACCTGGGCCTCTTCCCGACATTCTGGATTGTATGGTTTCGGTGCGT
TAAAGTGCTGTCGGATGGATGTGATATGTTGACTGTATGACGGCGATGCTGCCATCTGTG
TGATATTTGTTTAAAGTCAGTAAATTGGTAATCTGGTGGTGGTACAGATAAAATTTGAGT
TGCAGTTCAAGCTGGATTTATACATCATTTTCTTTTGTGC

CDS

555 bp

>Os10t0190000-02 Similar to Ubiquitin carrier protein.
AAGATGCTTAATCTTATCAAAATAAAGGATAAAAAGAAAGAGCAGGCAGCAAGTGCTGCT
GGAAAGGCTCCTGTGAAGAAGCAATCTGCTGGAGAGCTCCGTCTTCACAAAGATATTAGT
GAGCTAAACCTACCCAAGAGCACATCAATTTCTTTTCCCAATGGCAAGGATGATCTGATG
AATTTTGAGATCATCGTCCGACCTGATGAAGGATATTACCTAGGTGGCACTTTCGTCTTT
ACTTTTCAAGTCTCTCCCTCTTATCCTCATGAACCTCCAAAGGTGAAGTGCAAGACCAAG
GTATACCATCCAAATATTGATTTGGAAGGAAATGTATGCCTGAACATTTTGCGTGAAGAT
TGGAAGCCTGTTCTCAACATCAACACTGTTATTTATGGCCTTAACCTTCTTTTTACGCAA
CCAAACGATGAGGATCCGTTGAACCATGAAGCAGCAGCTGTCCTCCGTGACAACCCAAAG
CTGTTTGAAGCTAATGTTAAAAGGGCAATGGCCGGAGGCTATGTGGGTCAACACTATTTC
CCAAGATGTGCATGA

Protein

185 aa

>Os10t0190000-02 Similar to Ubiquitin carrier protein.
KMLNLIKIKDKKKEQAASAAGKAPVKKQSAGELRLHKDISELNLPKSTSISFPNGKDDLM
NFEIIVRPDEGYYLGGTFVFTFQVSPSYPHEPPKVKCKTKVYHPNIDLEGNVCLNILRED
WKPVLNINTVIYGLNLLFTQPNDEDPLNHEAAAVLRDNPKLFEANVKRAMAGGYVGQHYF
PRCA*

5'UTR

chr10:6244578..6244717 (+ strand) : 140 bp

chr10:6245974..6245974 (+ strand) : 1 bp

CDS

chr10:6245975..6246086 (+ strand) : 112 bp

chr10:6247639..6247747 (+ strand) : 109 bp

chr10:6248263..6248341 (+ strand) : 79 bp

chr10:6248430..6248546 (+ strand) : 117 bp

chr10:6249684..6249821 (+ strand) : 138 bp

3'UTR

chr10:6249822..6250065 (+ strand) : 244 bp

FASTA

>Os10t0190000-02 class=Sequence position=chr10:6244578..6250065 (+ strand)
gcgtaataga aagagagatc tcccgtctcg tccgtcgtct cctccgctcc ttgcgccaag acgagtcgcg gctcaacaga
ggaggggcgc cgatctccat ctggcgagca gagcagggga ggggaaggga aggtatcctg gtgagcatca acatcctctt
cctgattcat ctctctctcc caccgggact acttatgtct tggaatttgc ttgcgttcgt tcgttaaccc tagcttctct
tctagatctg gaagaagctc ttctcttaat ttcagagcct taatcttaat acaagtaata gtttgtttgt tcccccaaaa
gtttaggggt tcaactgtcc caactcccaa gttggatccg cccctgCCTG TGTAGAGCTC ATCTCCCTTA GCGTCGCCTA
TGATTCTGAG AGTTTCACCC CAACAGCCGT GTTGATGAGC TTTGTAACGA CCTGTTTTTC TCCTGCTCTT GATAAAATTA
GGCCAGCCTG ATTTAAGAAA AGAAGTAAAC ATTCTAGCTT TAATTTCCCG CTCGATTCGC ATGGGGTTAG ATTAATGTTT
CTTCTCGAGT ATGTATTGAG AAACCAAATC GTGCATGTGT TTATTTCTGG AAGGAGAAGT GCTATAAATG TCTGTAATGT
AGAAGCATTT TGTAAATGCA TGTGCATTGA GTTCTTTTTA TTCGTATCTC GAGAGTTTGT ACAATAAGAT GATTGTTCTG
CACACACCAA AAAATGGTGC AGCTGCAAAC ACCTTGTGGT TGTGCCTTCC TAAATACTAC AGAAACATTA ATGAGTCTAG
TGTAGATGGC CAAATGAAGC ACACTATTGT TATGGCATTA CGGTAAGGGC CAGGAGGTAT ATGCTTTCAA CCGTGTTGTG
TCTGGTCCCA ATGTTCTTAA GTTACAACCC AGGTGGAACA AATAAGAAAC AGGGCGTCCG GATTGGTTAG CTTGGTAATC
AGATTACACC AAAAAAAACC TGAACCAAAT GCCTCCTAAG TTTAGCCGAG CTACTTAGTT ACTGGTTGCT GCTTAGTGTA
TTAGTATTAT ATTTAAATTT TGGATCTTCC TGTTGTCAAA ACTCATCAAG TATTGTTTCT CCAGTCCCCT CTCAAGAAAT
CCTTTCTGGG CAGTTGAAGG TCGTGTTGAA TTTCCTTTTT GTGTTTTATT CATGTTTTAT GCTGTAATGG AAATAACAAA
ACAGAGTGAT GACTGATGTA GAGCAGACTT CTAGTCCTAA CCATTCCATT TTTTTGTGAT TAAGTTCTAA CCATTCGACT
AAAATAAACT ACACATCAGA GATGCAGAAA TGCAACTAAT TATGTTCTCT TTTGTGCTTT CATCAGGTGA TAGTGTTTTT
TCTCTGATTG TAAATCTTTT CCCCTTTTCT TTGCAGAAAG ATGCTTAATC TTATCAAAAT AAAGGATAAA AAGAAAGAGC
AGGCAGCAAG TGCTGCTGGA AAGGCTCCTG TGAAGAAGCA ATCTGCTGGA GAGCTCCGTC TTCACAAAGG TGCATTGAGT
TATAGATGAC TGTCAGCACT TCCTTTTGGT CATAAAAACA TGTTGTCTGG ACATTGACAG AGCCTTCACA GTGCAATCTT
TATCTCTAAT TTATTTTGTA ATGTAATTTA AAATACGATA AATTACAATA TTATGAAGAT AATTTTGATA CTAATCTACA
ATTCTGTATA TATATGATTA TTATGTATCT GATATTAATA TTTATTTTTT TTGTTATTTT AACTAGATGT GTGTCTAAAA
TGAATGTGTT CTTGTGACCA AAGTAATTAC CTTTGTTGAG TTCTCTTACA AAAATTTGTG AGCTAGACAT ACAATTCCTT
GAATTTTAAA CTTTTAACTA ACTCTCAAAG CTTATCAAAC TGTTCTCATA AATGTAATGT TTCCACTATC CTCACAGGTG
GTTTTTATTT GAATAATTTG ATGCTGGCAT GCTGCTGCAT ATGTGGCTAT GCTCTTTTTT AAGTTGTTAG CAATCTCTTT
ATTTTCATGT TGAGCATGAC TAGTAGTATA TGCGTCATGT GGGGCAGTCC TGCCGGCTGC CGGTGTCACC AAAGGGGACC
TGATAGTGCT CCAGCACACA TGCCAGATGT GGAACAGTAG CTCTCTCATC TTCTCTTTCC TTCATTTCTC TCCTTATTTC
CTCTCTTTCT TGAATCCTGA TCTAGAGGAG ATGGAGCAGC GAGGGTAGGA GCAGCACTGG GTTAATCAGT AGGAGAAGTG
ACAAAGAAGA TGATAGCAGG GATGTCAATT AATACTTACA GTTGCTATTC CTCATCGTGT GAAAGGAAAT TAAAGTGACA
GGTGGATGGC TATTCCAATC ATCCAATGCA GCGTATATTA ATTTGTGGCA CTTTAAGCTA GGTGTATGGT ATCTTATTTA
AGTAATGCAT TCCGTACACT GGCATGCTGT CTAGATGCCA TGGAATATGT GAAAGCAACT CTTCTAGCGA TTGTGCAAAT
GGCCAAACCT TGAATTTGTG GACCATCCAA GTTGGAGTGC CTTAAAAGAT TTTGCTTGAG GCCAAGAGCT ATATGCTTGC
ACGGACTAAG CCACAAGTCC ATGCGTGAAT GTGAGTATCT GTTGTTTGTA TGTGACCTAC TGGGGCTAAA TTTGGAATTT
TCAATTTCTC TTTTTTTGGT GGTTAAAGAA GTTAATTTCA ATTTCTATCA TTCGTCCAAA TTATTGAGTT TTGATACAAA
tactcccttt gttccacatt gcaagtcatt ttagttttgt cccaagtcaa aacttcttta actttgacta agttcataga
aaaatgcacc agtatcgaaa ataacaaata aatgcactgt catggtggtt ttaatgaaac taatttgata ttgtagatgt
tggtgcattt tttctaggaa tttggtcaaa gttagagaat tttgacttgg gacaaaatta aaatgactta caatatggaa
cagagggagt aGATTTTCAT ATTTTTTATT ATCATAAACT TCTCCTTGTT ACAACTTTAT CATGTCATAA ATTATTTATG
ACTTTATATG ATATTGGGCA GATATTAGTG AGCTAAACCT ACCCAAGAGC ACATCAATTT CTTTTCCCAA TGGCAAGGAT
GATCTGATGA ATTTTGAGAT CATCGTCCGA CCTGATGAAG GATATTACCT GTAAGTAGAA TGCATCTCTG TTTTGTGTTT
ATTATGTTGT TCTGCACTAC CTCACAAGTT TATGTCAATT TAAAGAACCT TCACTATTTT TAAAAGATCA TTTATGTCGT
GTTAAAAAAA AGCATTTACC AGTTCTTTCA GAATTATTTA TGGCAAAACA GGGGGTTATT TAAGGCAGAA TTATTTACCT
GTCTGTTGCC TAGTTAATAG GCATGCGGCA TGCCACTACT TAATGCGGAT ACTCCATCCT TGTTTGCCTT AACATAATCA
CATTTTGACT ACTGAGTTTT GTAAGCTTTC GAAGGCAGTC ATCTAGCACC TTCCAGCCTT GCTGATTTGT TCACATAGAT
GACTGACTAT CCTTATTTAG ACTCGCCTGA TTTGTTATAA GGTCCTAGGC TCTGATGAGC TGCGACTAGC ACTTGTGAAC
ACTGTTTTTT CTTTTTGCTT AAATGTCAAT TCTACATACC ATGTTCCCAC CTATAATTCT ATTTACAATG ATTTTTCCTT
TTTAGAGGTG GCACTTTCGT CTTTACTTTT CAAGTCTCTC CCTCTTATCC TCATGAACCT CCAAAGGTGA AGTGCAAGAC
CAAGGTATAA GATGGGGCTT TCTATGCTAT ATATTTTCCC AGTGAATATG TTGCCTCTTA ACCAATTTCT ATGCATTATA
ACTTGCATTC AGGTATACCA TCCAAATATT GATTTGGAAG GAAATGTATG CCTGAACATT TTGCGTGAAG ATTGGAAGCC
TGTTCTCAAC ATCAACACTG TTATTTATGG CCTTAACCTT CTTTTTACGG TATTTCAGTT TCCTTGACCC CTATTGATTG
CAATTATGTA TTTCGGAAAT AGATAAAAAA AACAAATATC TAATCATGTT TACAATGCTG TTCAAACCTA TCATATCATT
ATGCTTCGTT GTTTACGAGA TAAGGCCTTA TGTTTACGAT GCTGTTGTCA TCTACATTGT GCTTCATGGT GTTTGTGATA
CTCGTTTTCT ACTTTAAGCA GCAATGTGGT AATCTTATCA ATTTGAGAAA GGCATGCATA ATTCATGGTG TCCTATTTTT
GATGTACTTT AAGATTGAAT TCAATTCTCG ATGTATAGTC TTGGTACAGA AGTAAAAAAC TTATGCAAAG GTTTGTATAA
AGAACTATGA TATATTTTTA CTTATTTACT ATGTACAGGA GTATTAGTTA AATAGTTATA GTTGACATGA GTTCTCCATT
ATCTTGAATT AAATGTACAT AAAAAATTTG AGTAGTTTCT AAGTCACGGA TAAGTAAAAT TAGGCAGCCT AAATTTCTAT
GGAAGACGGA AGTTGATATA CTTATATGTA GTTTCTGAGT CATTGCAACC ATGATTTGTG TGGGTGATAT GTTAGAGCTG
TTTGGGCTGA GGTCTTTGGA TGCCAATTTC TTATCTTTAG TTATAATTTC CATACTGTTT TGTTTGTAAC TACAATGTGG
CCAAAACTTA GGTGAAAAAT TACCAAAATT TGTCAGTGTA GTGTGTTATT TCTTTGGCAC GAAAAAAACA GGCCAAAGCT
AAGCCCCAAG GCGCTTATTT GTTGACACCC ACTTCATTTT GTTTGGTTTT GAGTATGGAT GCTGGACTAG TAACATCAAT
CACAACTGGC ATAGTAAAAC TACTAAGAGG AAAAATTGCT CCCCTGAACC TTGTCATTGA GGATGACACC TTGGAGAAAC
CCTTGTTCTG TAACTTCTGT TGGCCAAACA TCTCAACGAA AGTGCCGGGT AGCATGAATG ATTTTTTTTT CCTTGAGATT
CTTGTTGGAT GATCAGATTA TACATTGCTT CCATTCCTTG AGATTCTTGT TGGATGATCA GATTATACAT TGCTTCCATT
GCCATTGGTG GGTTACAGTT TAGTAAGATT TCTTGTGGCT TAGTTTGCTT TTGATTTTGT CCGCAGCAAC CAAACGATGA
GGATCCGTTG AACCATGAAG CAGCAGCTGT CCTCCGTGAC AACCCAAAGC TGTTTGAAGC TAATGTTAAA AGGGCAATGG
CCGGAGGCTA TGTGGGTCAA CACTATTTCC CAAGATGTGC ATGATATGGT GCTGGGTGCC ACAAACATTA GTAAGTTAAG
CCACCTGGGC CTCTTCCCGA CATTCTGGAT TGTATGGTTT CGGTGCGTTA AAGTGCTGTC GGATGGATGT GATATGTTGA
CTGTATGACG GCGATGCTGC CATCTGTGTG ATATTTGTTT AAAGTCAGTA AATTGGTAAT CTGGTGGTGG TACAGATAAA
ATTTGAGTTG CAGTTCAAGC TGGATTTATA CATCATTTTC TTTTGTGC

Locus: Os10g0190000

Loading...

Locus: Os10g0190000

Loading...