Os10t0191100-00

Locus

Os10g0191100

Description

Similar to Protease inhibitor/seed storage/LTP family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLLA8, LLA8, OsHyPRP27, HyPRP27

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein-like AGP 8, non-specific lipid transfer protein-like arabinogalactan protein 8, Hybrid Proline-Rich Protein 27

Transcript Evidence

CT835784 (DDBJ, Best hit)

Protein Evidence

Q7G4M5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os10t0191100-00)

Others

Oryzabase (11335)

KEGG (Os10t0191100-00)

Transcript

985 bp

>Os10t0191100-00 Similar to Protease inhibitor/seed storage/LTP family protein.
ATGATATGAGCAGCACACACGTGTAGAGAGATTTTGAGAGATAGAGAATTCGAGCAATGG
CGCGAATTGTCTTGGTCGTTGCTTTTGCAGCCGTCGTCGTCGTCCAGGCCGCCATGGCAC
AGAGGCCAGGGATGCCGCCGGCCGTTGTTCCTCCTTCTCTGCCGACGACGACGCCGCCCG
CGCCGACCGTCGTCGCTCCTCCTCTGCCAACGACGCCGCCGCCGGCCGTCGTTGCCCCTT
CTCCTCCTCTGCCGCCGCTGACGCCGCCGCCGGCCATTGTCCCCCCTGCTCTACCGCCGC
CGCCGCCGCTGCCGGCCATCGTCGTTCCACCGGCTCTGCCGCCGACGCCTGCCATTGCTG
TTCCTCCTGCCCTGCCGCCGATCCCGGCCATCGTTCCTCCTTCCCTGCCGCCGACGCCAG
AGGCGAACCTGCCGTGCGTGGCGGAGCTGGCGCCGTGCTCCGAGTTCTACCGGAACGCGA
CGGCGAAGCCCACGGGCGCGTGCTGCGCGCCGCTGAAGAAGGCGTACGAGAGCGAGCTGG
GATGCCTGTGCTCCGTGCTGACGAACCCGGCGATGGCCGCCACCGTCGGCGTCGACACGA
AGAAGGGGTTGGATCTGTTCGGGCGCTGCGACGTCAAGGTTCCCGCCGACGTGTGCAGCA
GCCATGCGCCTGCTCCTGCTCCAGCCAGCAGTCCTCCCACAGCGTCTCCAAACTCAGACA
GCAGTGCCGCTCCTCATGGTGCCCAGTGGATGGTATATTCGAGCTTCTTCAGCATCCTCC
TTGTGGCTATGTCCATTCCTGTGTAATAAGATCATTATTTTTTCCTTCCTGGAGAGAATA
CGTTAATTTTCCCTTCTTATGTATGCATGTTGATTTGCATAGCTGGTCCTTTGCCTGGTT
GTCCACTATTCCTGGGGAACCTTATTAATTTGTTTCCTTTGAGCACTATTATTATTTGTT
ATTTCGAAAATGGTTATTATTTGAT

CDS

750 bp

>Os10t0191100-00 Similar to Protease inhibitor/seed storage/LTP family protein.
ATGGCGCGAATTGTCTTGGTCGTTGCTTTTGCAGCCGTCGTCGTCGTCCAGGCCGCCATG
GCACAGAGGCCAGGGATGCCGCCGGCCGTTGTTCCTCCTTCTCTGCCGACGACGACGCCG
CCCGCGCCGACCGTCGTCGCTCCTCCTCTGCCAACGACGCCGCCGCCGGCCGTCGTTGCC
CCTTCTCCTCCTCTGCCGCCGCTGACGCCGCCGCCGGCCATTGTCCCCCCTGCTCTACCG
CCGCCGCCGCCGCTGCCGGCCATCGTCGTTCCACCGGCTCTGCCGCCGACGCCTGCCATT
GCTGTTCCTCCTGCCCTGCCGCCGATCCCGGCCATCGTTCCTCCTTCCCTGCCGCCGACG
CCAGAGGCGAACCTGCCGTGCGTGGCGGAGCTGGCGCCGTGCTCCGAGTTCTACCGGAAC
GCGACGGCGAAGCCCACGGGCGCGTGCTGCGCGCCGCTGAAGAAGGCGTACGAGAGCGAG
CTGGGATGCCTGTGCTCCGTGCTGACGAACCCGGCGATGGCCGCCACCGTCGGCGTCGAC
ACGAAGAAGGGGTTGGATCTGTTCGGGCGCTGCGACGTCAAGGTTCCCGCCGACGTGTGC
AGCAGCCATGCGCCTGCTCCTGCTCCAGCCAGCAGTCCTCCCACAGCGTCTCCAAACTCA
GACAGCAGTGCCGCTCCTCATGGTGCCCAGTGGATGGTATATTCGAGCTTCTTCAGCATC
CTCCTTGTGGCTATGTCCATTCCTGTGTAA

Protein

250 aa

>Os10t0191100-00 Similar to Protease inhibitor/seed storage/LTP family protein.
MARIVLVVAFAAVVVVQAAMAQRPGMPPAVVPPSLPTTTPPAPTVVAPPLPTTPPPAVVA
PSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPPTPAIAVPPALPPIPAIVPPSLPPT
PEANLPCVAELAPCSEFYRNATAKPTGACCAPLKKAYESELGCLCSVLTNPAMAATVGVD
TKKGLDLFGRCDVKVPADVCSSHAPAPAPASSPPTASPNSDSSAAPHGAQWMVYSSFFSI
LLVAMSIPV*

5'UTR

chr10:6307276..6307331 (- strand) : 56 bp

CDS

chr10:6306654..6307275 (- strand) : 622 bp

chr10:6305927..6305953 (- strand) : 27 bp

chr10:6305436..6305536 (- strand) : 101 bp

3'UTR

chr10:6305257..6305435 (- strand) : 179 bp

FASTA

>Os10t0191100-00 class=Sequence position=chr10:6305257..6307331 (- strand)
ATGATATGAG CAGCACACAC GTGTAGAGAG ATTTTGAGAG ATAGAGAATT CGAGCAATGG CGCGAATTGT CTTGGTCGTT
GCTTTTGCAG CCGTCGTCGT CGTCCAGGCC GCCATGGCAC AGAGGCCAGG GATGCCGCCG GCCGTTGTTC CTCCTTCTCT
GCCGACGACG ACGCCGCCCG CGCCGACCGT CGTCGCTCCT CCTCTGCCAA CGACGCCGCC GCCGGCCGTC GTTGCCCCTT
CTCCTCCTCT GCCGCCGCTG ACGCCGCCGC CGGCCATTGT CCCCCCTGCT CTACCGCCGC CGCCGCCGCT GCCGGCCATC
GTCGTTCCAC CGGCTCTGCC GCCGACGCCT GCCATTGCTG TTCCTCCTGC CCTGCCGCCG ATCCCGGCCA TCGTTCCTCC
TTCCCTGCCG CCGACGCCAG AGGCGAACCT GCCGTGCGTG GCGGAGCTGG CGCCGTGCTC CGAGTTCTAC CGGAACGCGA
CGGCGAAGCC CACGGGCGCG TGCTGCGCGC CGCTGAAGAA GGCGTACGAG AGCGAGCTGG GATGCCTGTG CTCCGTGCTG
ACGAACCCGG CGATGGCCGC CACCGTCGGC GTCGACACGA AGAAGGGGTT GGATCTGTTC GGGCGCTGCG ACGTCAAGGT
TCCCGCCGAC GTGTGCAGCA GCCATGCGCC TGCTCCTGGT ACGTATATGC GTAGTAATAA CATGATGTTG ACAGAATGTT
CGTCTTTCTT GATAAGAGTA TTTGCCAACT TAGGCTgtgt ttagactcgg tggctgaaaa gtttcggcgt gtcacatcgg
atataatgac gcatatttga agtattaaat atagactaat aacaaaacaa attacagatt ccgcatgtaa actgcgagac
gaatttatta agcctgatta atctatcatt agcaaatatt tactgtagca ccatattgtc aaatcatgga gcaattaggc
ttaaaagatt cgtctcgcaa tttacacgca aattgtgtaa ttagtttttt tttcgtttat atttaatact ccatgcatgt
gtccaaacat tcaatgtgac aggtgaaaaa ttttgtcagg ggatctaaac aggcTCTTGT TAGTGTGATA TTGTATAATC
AGTCAGGGTT TACAATTTCG TAAAATACCG AAGTTTCGGG TCACTGAAAT TTGGGAAAGT GCTGGTACGA AATTAGTTAA
AATTTAAATA AATTTTGACC AAAATTTCAA AAATGTAAAA GAATCCGAAA TTTTTGGAGC AAATGGTTGT GTACCGGGGG
TCCGAAACTC CCGAAAATTT GAAAATTTCA AACCCGTAAT ACTTAAATAT GATTACCGTA TTACTGATAC ATCTGTCTTT
TCTTTTTTTG TTTTTCAGCT CCAGCCAGCA GTCCTCCCAC AGCGTGTAAG TGCAACTTCG TGTTTTTCTT TTTCATGTTT
CCACGtactc cctctgtttt ttaatagatg acgctgttga ctttttctca catgtttgat cattcgtctt atttaaaaat
tttatacaaa tgtataagat ataaatcata cttaaagtac tatgagtgat aaaacaactc ataacaaaat aaattataat
tacgtaaatt ttttgaataa gacgaatggt caaacatgtg aaaaaaagtc aacggcgtca tctattaaaa aacagaggta
gtaTTAACTT CTCAAAAATT AAATTAATAT TTATTTTCCG ATAATTTCTT TTGTTGTTTT ATACTTTTTA ACTTTCCTTT
CTAAATAATT TCCTTTCTCG CTTCAATGAT TTCAGCTCCA AACTCAGACA GCAGTGCCGC TCCTCATGGT GCCCAGTGGA
TGGTATATTC GAGCTTCTTC AGCATCCTCC TTGTGGCTAT GTCCATTCCT GTGTAATAAG ATCATTATTT TTTCCTTCCT
GGAGAGAATA CGTTAATTTT CCCTTCTTAT GTATGCATGT TGATTTGCAT AGCTGGTCCT TTGCCTGGTT GTCCACTATT
CCTGGGGAAC CTTATTAATT TGTTTCCTTT GAGCACTATT ATTATTTGTT ATTTCGAAAA TGGTTATTAT TTGAT

Locus: Os10g0191100

Loading...

Locus: Os10g0191100

Loading...