Os10t0194200-01

Locus

Os10g0194200

Description

Similar to Mannitol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD1

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 1

Oryzabase Gene Symbol Synonym(s)

OsCAD1

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 1

Transcript Evidence

AK068221 (DDBJ, Best hit)

Protein Evidence

B4FBW5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Full-length cDNA

J013135D23 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0194200-01)

Others

Oryzabase (10430)

Transcript

1441 bp

>Os10t0194200-01 Similar to Mannitol dehydrogenase.
agggccgTaaaggaaaatcttccgtgtcgtcgtctcctccgctccttgcgccaagacgag
tcgcggctcaacagcggagaggcggcgatctcccatctggcgagcagagcaggggagggg
aagggatcttgTTAGAGTGGCATGGCTGCTGAATGTGGAAGTGGCAACTGTGATGCTTGG
GCAGCGAGAGATCCTTCAGGGATCCTCTCCCCGTACAAGTTCAACCGCAGGGCTGTACAA
AGTGACGATGTTTCCTTGAGGATCACACACTGTGGTGTTTGTTATGCTGATGTTGCATGG
ACAAGGAATATACTCAACAATTCGATGTACCCTTTAGTCCCTGGGCATGAGATAGCAGGA
GTTGTAACTGAGGTTGGTGCAGACGTCAAGAGCTTCAAAGTGGGTGACCATGTAGGTGTT
GGCACATACGTGAATTCATGCCGGGACTGTGAGAACTGCAATAGCTCTCTAGAGAACTAC
TGCTCACAACATGTCTTCACTTTCAATGGTGTTGACACTGATGGGACTGTCACAAAGGGA
GGATATTCTACTCACATAGTAGTACATGAGAGGTATTGCTTTAAAATACCTGATGGCTAC
CCTTTGGAAAAGGCAGCACCTTTACTTTGTGCTGGCATCACTGTATATAGTCCGATGATG
CGGCATAATATGAACCAGCCAGGGAAGTCACTCGGCGTCATTGGACTTGGTGGCTTGGGT
CACATGGCAGTAAAATTTGGGAAAGCCTTTGGACTGAAAGTCACAGTTATTAGTACTAGT
GAATCAAAGAGAAAAGAAGCTATTGACCTTCTTGGTGCAGATAATTTCGTGGTGTCATCG
GATGAAAATCAGATGGAGACCTTGAAAAGCTCTCTGAACTTCATTATTGACACAGCCTCC
GGCGATCACCCATTCGATCCTTATCTCACGCTTCTGAAAGTTGGTGGTGTAATGGCACTA
CTTAGCTTCCCAAGTGAAATCAAAGTGCATCCTGCAAACCTTAATCTCGGTGGGCGGAGT
TTATCTGGTAGTGTAACTGGAGGTACGAAGGACATCCAGGAGATGATAAACTTCTGTGCG
GCAAACAAAATCTACCCAGATATCGAGATGATCAAGATAGATTACATCAACGAGGCTCTT
CAGAGGCTTGTTGACCGGGATGTCAGATTTCGCTTTGTAATCGACATTGAGAACTCGTTC
AAGTAGTATCTTGATATCTTCAGTACACCATTAATGATAGAAGTGTATGCAATAATAATA
AGTTTAAATGTCCTACAAGATGATGAGACCATGAGACAGTTCCAGAACAAAATGTTCCAT
TTTAAGAAGCAATTTGGTTCTGTTTTCAGTTATTTTCAGgagtaaattgtattggtggta
cacaaacttatttggtgggtgtaatttaatacataaacttgtTTGTTGGGtgtaatttag
t

CDS

1065 bp

>Os10t0194200-01 Similar to Mannitol dehydrogenase.
ATGGCTGCTGAATGTGGAAGTGGCAACTGTGATGCTTGGGCAGCGAGAGATCCTTCAGGG
ATCCTCTCCCCGTACAAGTTCAACCGCAGGGCTGTACAAAGTGACGATGTTTCCTTGAGG
ATCACACACTGTGGTGTTTGTTATGCTGATGTTGCATGGACAAGGAATATACTCAACAAT
TCGATGTACCCTTTAGTCCCTGGGCATGAGATAGCAGGAGTTGTAACTGAGGTTGGTGCA
GACGTCAAGAGCTTCAAAGTGGGTGACCATGTAGGTGTTGGCACATACGTGAATTCATGC
CGGGACTGTGAGAACTGCAATAGCTCTCTAGAGAACTACTGCTCACAACATGTCTTCACT
TTCAATGGTGTTGACACTGATGGGACTGTCACAAAGGGAGGATATTCTACTCACATAGTA
GTACATGAGAGGTATTGCTTTAAAATACCTGATGGCTACCCTTTGGAAAAGGCAGCACCT
TTACTTTGTGCTGGCATCACTGTATATAGTCCGATGATGCGGCATAATATGAACCAGCCA
GGGAAGTCACTCGGCGTCATTGGACTTGGTGGCTTGGGTCACATGGCAGTAAAATTTGGG
AAAGCCTTTGGACTGAAAGTCACAGTTATTAGTACTAGTGAATCAAAGAGAAAAGAAGCT
ATTGACCTTCTTGGTGCAGATAATTTCGTGGTGTCATCGGATGAAAATCAGATGGAGACC
TTGAAAAGCTCTCTGAACTTCATTATTGACACAGCCTCCGGCGATCACCCATTCGATCCT
TATCTCACGCTTCTGAAAGTTGGTGGTGTAATGGCACTACTTAGCTTCCCAAGTGAAATC
AAAGTGCATCCTGCAAACCTTAATCTCGGTGGGCGGAGTTTATCTGGTAGTGTAACTGGA
GGTACGAAGGACATCCAGGAGATGATAAACTTCTGTGCGGCAAACAAAATCTACCCAGAT
ATCGAGATGATCAAGATAGATTACATCAACGAGGCTCTTCAGAGGCTTGTTGACCGGGAT
GTCAGATTTCGCTTTGTAATCGACATTGAGAACTCGTTCAAGTAG

Protein

355 aa

>Os10t0194200-01 Similar to Mannitol dehydrogenase.
MAAECGSGNCDAWAARDPSGILSPYKFNRRAVQSDDVSLRITHCGVCYADVAWTRNILNN
SMYPLVPGHEIAGVVTEVGADVKSFKVGDHVGVGTYVNSCRDCENCNSSLENYCSQHVFT
FNGVDTDGTVTKGGYSTHIVVHERYCFKIPDGYPLEKAAPLLCAGITVYSPMMRHNMNQP
GKSLGVIGLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFVVSSDENQMET
LKSSLNFIIDTASGDHPFDPYLTLLKVGGVMALLSFPSEIKVHPANLNLGGRSLSGSVTG
GTKDIQEMINFCAANKIYPDIEMIKIDYINEALQRLVDRDVRFRFVIDIENSFK*

5'UTR

chr10:6540786..6540916 (+ strand) : 131 bp

chr10:6541749..6541758 (+ strand) : 10 bp

CDS

chr10:6541759..6541847 (+ strand) : 89 bp

chr10:6542230..6542343 (+ strand) : 114 bp

chr10:6542494..6542721 (+ strand) : 228 bp

chr10:6542981..6543266 (+ strand) : 286 bp

chr10:6543433..6543583 (+ strand) : 151 bp

chr10:6543698..6543894 (+ strand) : 197 bp

3'UTR

chr10:6543895..6544129 (+ strand) : 235 bp

FASTA

>Os10t0194200-01 class=Sequence position=chr10:6540786..6544129 (+ strand)
agggccgTaa aggaaaatct tccgtgtcgt cgtctcctcc gctccttgcg ccaagacgag tcgcggctca acagcggaga
ggcggcgatc tcccatctgg cgagcagagc aggggagggg aagggatctt ggtgagcatc cacatcctct tcctgactca
tctctctccc accgggagta cttctgtctg gaatttgctt gcgttaaccc tagcttctgt tctaggtttg gaagaagctc
ttctcttaat ttcagagcct taatcttaat acaagtgaca gtttgtttgt tccccaaaaa gCTGAATCCG CCCCTGTCCA
GTGGTACGAA TTCAGTTTCT GTAGCTGCCA GAAGAAGTAA ATTAAATTTC ATGTTATACC ATGTTCTGAA ACTCTCAAGA
ATGTTGATGG AAGTTGATGG GGTTCTAGTG TATAAAACTG GATCAGTATT TCTGGTTATT GATTGGGTTT CACAAACTGT
GGAAGTATAA ATTGGATATT ATAGAGTACA AGGAGCAGAG ATGGGGCCTA ACACATGACA CGTGCGTTAC AAAGGAGAAC
TGGAGAAGAG GTGGATTCCT TCTCAAATTC CCCGCCCACA GATTCCCATC TCCAACCTCC ATCTCCGTCT CCTCAGAGAT
CCACATAGCG ACTCCCGATC CAGACTAAGC TTGCAAAACT CCCTTGCCCC AGCAGCGTCG ACAGTGTGGT GCTGACCGGC
GGCTTCTGAT CAAAATAGTC AGTTGGATTG GTCCTGTCCT GTCCTGTCCT GGTCCTGAAC CTCTAATCTC TTCATTTCAA
AACGAATAGA TGACTGGATT CATTTTCCTG CATTTTAAAC TACTGGTTTT TCTTTTTGTT GTTTTTGACA TTGTTCATTG
CTGATATAAG TATCAGGGGT ATAAGATTAT GATGGATTTA TGGCATTATG GGTTCATCTG AGTTGATTTT TTTCTATCTG
CAGTTAGAGT GGCATGGCTG CTGAATGTGG AAGTGGCAAC TGTGATGCTT GGGCAGCGAG AGATCCTTCA GGGATCCTCT
CCCCGTACAA GTTCAACCGC AGGTTAAATC ACACTACACT CCCTTGTGTA TTGATTTTCC TTTTTATTTT CTTGATATGA
ATGTCTTTCC AGCACTGTTA AGAAATCTTC CTTGTTTCCA AGTGTTTTCT CTAACTGCAG AATGCACTAT TCTGGCAACT
AGAATCATCA CGATTGCAGT TTCAGTTAGC TGTGTGCTTA TCTGGAACAA GAATGTGAAC TTGTCAAGTT ACCTGTTTTG
AATTTTCTAA CTTTTGCGCA ACATGATAAA CTGGATTACA AAATCTCTAT AGTACTTTGC TGAATGTTGT GATTAACTAC
TCACAGACAA GATTTTAAAA TGATCTTTTC CATTTTTAGT ACCTATTCTT ATGAATTGTT AATAACCTGG TTTATTATTA
CCAGGGCTGT ACAAAGTGAC GATGTTTCCT TGAGGATCAC ACACTGTGGT GTTTGTTATG CTGATGTTGC ATGGACAAGG
AATATACTCA ACAATTCGAT GTACCCTTTA GTCCCTGGGT AAAATTATTA ACTTTGTTAC TTGAATTTTA ACAAAAGTAT
GGAAAAGAAT AAACTTCTGT TACAGACTAT AAATTCATCC ATTTAGCTAC TGTATTTGTT GTAAAGATAA AAGTTCATGA
AATTGTGTCT AAATTTCAAT ATGAGTAGGC ATGAGATAGC AGGAGTTGTA ACTGAGGTTG GTGCAGACGT CAAGAGCTTC
AAAGTGGGTG ACCATGTAGG TGTTGGCACA TACGTGAATT CATGCCGGGA CTGTGAGAAC TGCAATAGCT CTCTAGAGAA
CTACTGCTCA CAACATGTCT TCACTTTCAA TGGTGTTGAC ACTGATGGGA CTGTCACAAA GGGAGGATAT TCTACTCACA
TAGTAGTACA TGAGAGGTAT GGATTTTGAC CATGTTTTCT TCTGAAAGTT TTCTGACAAG ACAACGAAAA ATTTCATATA
CTTATTTCTA ATGGTTGCTC AACAATGTTG TCACAAAATC ATCCTACATT CTGCTATGTA AATTTTATAT AGGAAACAAA
TCCCATGATG TTCTGCTAAT GTCTCTCTTA TGAATATAGC AGCTATTAGT TATTCCTGTT TACTTAATTC AAAAAAGAAC
CTATGAGAAA ATTGCATCTT CCTTTGGAAT GGCAGGTATT GCTTTAAAAT ACCTGATGGC TACCCTTTGG AAAAGGCAGC
ACCTTTACTT TGTGCTGGCA TCACTGTATA TAGTCCGATG ATGCGGCATA ATATGAACCA GCCAGGGAAG TCACTCGGCG
TCATTGGACT TGGTGGCTTG GGTCACATGG CAGTAAAATT TGGGAAAGCC TTTGGACTGA AAGTCACAGT TATTAGTACT
AGTGAATCAA AGAGAAAAGA AGCTATTGAC CTTCTTGGTG CAGATAATTT CGTGGTGTCA TCGGATGAAA ATCAGATGGA
GGTAATACAC ATTCTACATT ATGTTTTACC CCATTGTTCA CAGTTATCTA CTATGACCAT ACCATGAGTC TTATCAGTCA
AATGCCATTT GGTAAAGATA GCTAACCTGT ACTTCTCATT TATCTTACGT ACTGAAAGTG GTAATGACAG ATTCTTCATT
GTTGCAGACC TTGAAAAGCT CTCTGAACTT CATTATTGAC ACAGCCTCCG GCGATCACCC ATTCGATCCT TATCTCACGC
TTCTGAAAGT TGGTGGTGTA ATGGCACTAC TTAGCTTCCC AAGTGAAATC AAAGTGCATC CTGCAAACCT TAATCTCGGT
AATGCACGTT TCTCATACCA AAATATATAT GGCTTTTTCC AGAGAGGAAA TATATCTGTC TGCTAGGATG GGGAGAAAAT
TAATTAATTA CAACTAATCT GGACTCATGT AGGTGGGCGG AGTTTATCTG GTAGTGTAAC TGGAGGTACG AAGGACATCC
AGGAGATGAT AAACTTCTGT GCGGCAAACA AAATCTACCC AGATATCGAG ATGATCAAGA TAGATTACAT CAACGAGGCT
CTTCAGAGGC TTGTTGACCG GGATGTCAGA TTTCGCTTTG TAATCGACAT TGAGAACTCG TTCAAGTAGT ATCTTGATAT
CTTCAGTACA CCATTAATGA TAGAAGTGTA TGCAATAATA ATAAGTTTAA ATGTCCTACA AGATGATGAG ACCATGAGAC
AGTTCCAGAA CAAAATGTTC CATTTTAAGA AGCAATTTGG TTCTGTTTTC AGTTATTTTC AGgagtaaat tgtattggtg
gtacacaaac ttatttggtg ggtgtaattt aatacataaa cttgtTTGTT GGGtgtaatt tagt

Locus: Os10g0194200

Loading...

Locus: Os10g0194200

Loading...