Os10t0206800-01

Locus

Os10g0206800

Description

Multidrug and toxic compound extrusion (MATE) protein, Al-induced secretion of citrate

RAP-DB Gene Symbol Synonym(s)

OsFRDL2

RAP-DB Gene Name Synonym(s)

FRD3-like protein 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFRDL2

Oryzabase Gene Name Synonym(s)

FRD3-like protein 2

Transcript Evidence

AK101612

Protein Evidence

Q8S6Q1

Literature

PMID: 26872836

Note

Manual Curation

May 18, 2016

Gene Ontology (GO)

Biological Process: drug transmembrane transport (GO:0006855)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: drug transmembrane transporter activity (GO:0015238)

Molecular Function: antiporter activity (GO:0015297)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Multi antimicrobial extrusion protein (IPR002528)

Full-length cDNA

J033052E02 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0206800-01)

RiceXPro (AK101612)

Others

Oryzabase (11140)

KEGG (Os10t0206800-01)

Transcript

2051 bp

>Os10t0206800-01 Multidrug and toxic compound extrusion (MATE) protein, Al-induced secretion of citrate
GTCCTCCAAAGCACCAGCGCCGGCAGGAGGGCCCCCCGCCGGATTCGATTCCCGGCACGT
CCTTCTCCTCCCTTTCTCGCGGGCGCCGCACGCCCCTTCCCCCTCCTCCTCCTCCTCTTG
GTCTGATGAATGGGGAGAGCCTCCTCGACCGCAGCTCCTCCGCCGACGCCGCCATGAACG
ACGCCGTGCCCGGCCACCGCCACCACCACCCGCTTAGCGTCTTCCTCCGGGACGCCAGGT
TGGCGTTCAGGTGGGACGAGCTCGGGAGGGAGATCATGGGGATTGCGGTGCCCGGCGCGC
TCGCCCTCATGGCTGACCCGGTCGCCTCGCTCGTCGACACCGCCTTCATTGGCCACATAG
GCCCAGTTGAACTTGCAGCTGTTGGTGTATCTATTGCCGTGTTTAATCAAGTATCAAGGA
TTGCAATATTTCCCCTTGTCAGTGTCACGACATCATTTGTTGCGGAGGAAGATGCTACAT
CCAGTGACAGAGAAAAATATGAAATAAATGGCGAGAATGAATTCAATGTTTCAGACAGTG
AAATGGAAGAGCTGGTTTCTCATGAAGAGGCTAGTGCTGCTCCCAGTAAGTCGTCTTTCG
AAACTGACTCAAGTGATGTCAAAATTGAACATAAGCGGAAAAACATTCCATCGGTGTCTA
CAGCATTACTACTTGGTGGGGTGCTCGGCCTTTTACAAGCACTGCTTCTTGTTATTTGCG
CAAAACCTCTCTTAGGCTACATGGGTGTGAAACAGGGCTCTGCAATGTTGATGCCAGCAC
TAAAGTACTTGGTAGTCAGATCTCTTGGTGCTCCTGCTGTGCTTTTATCTCTGGCAATGC
AAGGGGTATTTCGTGGACTTAAAGATACAAAGACACCTCTTTATGCAACTGTGGCTGGAG
ATGCAACCAACATAGTTTTGGATCCAATATTTATGTTTGTCTTCCAGTATGGTGTCAGTG
GTGCAGCAATTGCTCATGTTATATCACAATATTTCATTGCATCCATTCTCTTATGGAGGT
TAAGGCTACATGTTGACCTACTTCCACCCAGCTTTAAACATATGCAGTTCAGTCGATTCC
TTAAAAACGGTTTCCTATTACTTGCCAGAGTTATTGCTGCAACATGCTGCGTGACACTAT
CTGCATCAATGGCTGCACGGCTAGGTTCAGTTCCAATGGCTGCATTTCAGATTTGCTTGC
AGATCTGGCTGGCTTCGTCTCTTCTTGCTGATGGATTGGCTTTTGCAGGACAGGCTATAC
TTGCAAGTGCATTTGCTCGTCAAGACCATTCTAAGGCCGCAGCCACAGCTTCTCGTATAT
TGCAGCTGGGATTGGTTTTAGGACTTCTCCTAAGCATTTTTCTTGGCATTGGCCTCCGTT
TAGGATCAAGGTTATTTACTGATGACCAGGATGTTCTACATCATATTTACCTAGGCATAC
CGTTTGTCTCTCTGACTCAACCAATCAATGCGTTAGCTTTTGTTTTTGATGGTATCAATT
ATGGAGCATCAGATTTTGGATATGCTGCTTATTCAATGATTCTTGTGGCAATTGTCAGCA
TCATCTTCATAGTCACACTAGCAAGTTACAATGGTTTTGTCGGAATTTGGATAGCTTTGA
CAGTCTACATGAGCCTCCGAATGCTTGCAGGATTCTTAAGGATAGGGACTGCACGAGGAC
CATGGACTTTCTATGCAGCTCAACGCATGCATTCTCATGAGGTGGTTGGACTTTGTTGAA
CAATACTATAGGAAGACACCATGGATACTTTGTAAGGTTTTGCAGGTTTGGTGGGAATGG
AGGTTGTTTGAACAAAAGAAAATATTCAACTGTCATGTACATAGATAATCACACATGTTA
CTACTATTCTAATAGATTCTCCCCTGTCGTGTATGTTGTATTTGCCCATGTATAGTTCAG
TATGTTCGGCTGGCTATTTTGTAACAAGTTTGGATATAAAGTCACGTAGCATAAGATGTT
TGCACACCGTGAGATATACGGAGCATTGGCATTTGATTTTTAAAACATTAATGGAAATTT
TACCAGATGCC

CDS

1614 bp

>Os10t0206800-01 Multidrug and toxic compound extrusion (MATE) protein, Al-induced secretion of citrate
ATGAATGGGGAGAGCCTCCTCGACCGCAGCTCCTCCGCCGACGCCGCCATGAACGACGCC
GTGCCCGGCCACCGCCACCACCACCCGCTTAGCGTCTTCCTCCGGGACGCCAGGTTGGCG
TTCAGGTGGGACGAGCTCGGGAGGGAGATCATGGGGATTGCGGTGCCCGGCGCGCTCGCC
CTCATGGCTGACCCGGTCGCCTCGCTCGTCGACACCGCCTTCATTGGCCACATAGGCCCA
GTTGAACTTGCAGCTGTTGGTGTATCTATTGCCGTGTTTAATCAAGTATCAAGGATTGCA
ATATTTCCCCTTGTCAGTGTCACGACATCATTTGTTGCGGAGGAAGATGCTACATCCAGT
GACAGAGAAAAATATGAAATAAATGGCGAGAATGAATTCAATGTTTCAGACAGTGAAATG
GAAGAGCTGGTTTCTCATGAAGAGGCTAGTGCTGCTCCCAGTAAGTCGTCTTTCGAAACT
GACTCAAGTGATGTCAAAATTGAACATAAGCGGAAAAACATTCCATCGGTGTCTACAGCA
TTACTACTTGGTGGGGTGCTCGGCCTTTTACAAGCACTGCTTCTTGTTATTTGCGCAAAA
CCTCTCTTAGGCTACATGGGTGTGAAACAGGGCTCTGCAATGTTGATGCCAGCACTAAAG
TACTTGGTAGTCAGATCTCTTGGTGCTCCTGCTGTGCTTTTATCTCTGGCAATGCAAGGG
GTATTTCGTGGACTTAAAGATACAAAGACACCTCTTTATGCAACTGTGGCTGGAGATGCA
ACCAACATAGTTTTGGATCCAATATTTATGTTTGTCTTCCAGTATGGTGTCAGTGGTGCA
GCAATTGCTCATGTTATATCACAATATTTCATTGCATCCATTCTCTTATGGAGGTTAAGG
CTACATGTTGACCTACTTCCACCCAGCTTTAAACATATGCAGTTCAGTCGATTCCTTAAA
AACGGTTTCCTATTACTTGCCAGAGTTATTGCTGCAACATGCTGCGTGACACTATCTGCA
TCAATGGCTGCACGGCTAGGTTCAGTTCCAATGGCTGCATTTCAGATTTGCTTGCAGATC
TGGCTGGCTTCGTCTCTTCTTGCTGATGGATTGGCTTTTGCAGGACAGGCTATACTTGCA
AGTGCATTTGCTCGTCAAGACCATTCTAAGGCCGCAGCCACAGCTTCTCGTATATTGCAG
CTGGGATTGGTTTTAGGACTTCTCCTAAGCATTTTTCTTGGCATTGGCCTCCGTTTAGGA
TCAAGGTTATTTACTGATGACCAGGATGTTCTACATCATATTTACCTAGGCATACCGTTT
GTCTCTCTGACTCAACCAATCAATGCGTTAGCTTTTGTTTTTGATGGTATCAATTATGGA
GCATCAGATTTTGGATATGCTGCTTATTCAATGATTCTTGTGGCAATTGTCAGCATCATC
TTCATAGTCACACTAGCAAGTTACAATGGTTTTGTCGGAATTTGGATAGCTTTGACAGTC
TACATGAGCCTCCGAATGCTTGCAGGATTCTTAAGGATAGGGACTGCACGAGGACCATGG
ACTTTCTATGCAGCTCAACGCATGCATTCTCATGAGGTGGTTGGACTTTGTTGA

Protein

538 aa

>Os10t0206800-01 Multidrug and toxic compound extrusion (MATE) protein, Al-induced secretion of citrate
MNGESLLDRSSSADAAMNDAVPGHRHHHPLSVFLRDARLAFRWDELGREIMGIAVPGALA
LMADPVASLVDTAFIGHIGPVELAAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDATSS
DREKYEINGENEFNVSDSEMEELVSHEEASAAPSKSSFETDSSDVKIEHKRKNIPSVSTA
LLLGGVLGLLQALLLVICAKPLLGYMGVKQGSAMLMPALKYLVVRSLGAPAVLLSLAMQG
VFRGLKDTKTPLYATVAGDATNIVLDPIFMFVFQYGVSGAAIAHVISQYFIASILLWRLR
LHVDLLPPSFKHMQFSRFLKNGFLLLARVIAATCCVTLSASMAARLGSVPMAAFQICLQI
WLASSLLADGLAFAGQAILASAFARQDHSKAAATASRILQLGLVLGLLLSIFLGIGLRLG
SRLFTDDQDVLHHIYLGIPFVSLTQPINALAFVFDGINYGASDFGYAAYSMILVAIVSII
FIVTLASYNGFVGIWIALTVYMSLRMLAGFLRIGTARGPWTFYAAQRMHSHEVVGLC*

5'UTR

chr10:7574038..7574162 (+ strand) : 125 bp

CDS

chr10:7574163..7574275 (+ strand) : 113 bp

chr10:7574365..7574486 (+ strand) : 122 bp

chr10:7575678..7575884 (+ strand) : 207 bp

chr10:7575966..7576153 (+ strand) : 188 bp

chr10:7576555..7576690 (+ strand) : 136 bp

chr10:7577035..7577131 (+ strand) : 97 bp

chr10:7577262..7577362 (+ strand) : 101 bp

chr10:7577706..7577869 (+ strand) : 164 bp

chr10:7578091..7578279 (+ strand) : 189 bp

chr10:7578467..7578561 (+ strand) : 95 bp

chr10:7578651..7578773 (+ strand) : 123 bp

chr10:7579497..7579575 (+ strand) : 79 bp

3'UTR

chr10:7579576..7579887 (+ strand) : 312 bp

FASTA

>Os10t0206800-01 class=Sequence position=chr10:7574038..7579887 (+ strand)
GTCCTCCAAA GCACCAGCGC CGGCAGGAGG GCCCCCCGCC GGATTCGATT CCCGGCACGT CCTTCTCCTC CCTTTCTCGC
GGGCGCCGCA CGCCCCTTCC CCCTCCTCCT CCTCCTCTTG GTCTGATGAA TGGGGAGAGC CTCCTCGACC GCAGCTCCTC
CGCCGACGCC GCCATGAACG ACGCCGTGCC CGGCCACCGC CACCACCACC CGCTTAGCGT CTTCCTCCGG GACGCCAGGT
TGTTAACCGA GTCATCGGTC TATCGATTTT TTTCCCTTTC CATCTATTTA TCTCTGAGTT TTTATTTTCT TGGGGGTCCT
GTTGCAGGTT GGCGTTCAGG TGGGACGAGC TCGGGAGGGA GATCATGGGG ATTGCGGTGC CCGGCGCGCT CGCCCTCATG
GCTGACCCGG TCGCCTCGCT CGTCGACACC GCCTTCATTG GCCACATAGG TTTGCTTCTC TTCTCTCCTT ATTTTCCTTA
TTTTTTTTAA TTTTTTCCCC TTACTGCTGA CTTCGTTGTG AAGTTTCCAC CACCAGTTCT GACCTGCTCC AGGTGGGATT
GGAACGTACT CTGTTCTACC CTTCGGCCTT GGTCGCACGA TGTAATTTTA ATACTACTAG ATTTCTTTTC AGCTTGGAGC
AAACCTAACC CAGTTCATTC CGTTAGTGGT AGGAATTAAG GTGTGGTGTT TGGTCCTGAC TATTACGAAA TTTATCTGGC
TGTGCTGGTA ATAGATCTCG CTTCCATAAT GTCGAACCTA AAAAAATGAA GCAGTAGTTT GTAAAGTAGT AGAGTCTTTT
GCCGACATCG TGGCTGATGG TTGCCATTGT TTAGAATATT GATACTAACC CTAATATTTC ATTGCTAAGT ATTAAAACAA
AATTTTAATG CTTTCAATTC AAGGGTTAGT GTGTAGTTAT GTAGTACGGT GCCCTTAAAT GTCTTAACAT CAAAGTTGAT
TGTCAGATAG GTTTTTTATT GATGAATTCT GTAAGAAAGC AATCAAAAAG CATAAAGTTG GATAATGACC ATTGTTTAAG
GTCAACGCAA ACTGGCCATA TTTTATATTC AGCAAGTATG TATGGTAATA CTAATGAATC AATGTCATGT AAAATAGATG
TAGAATTAAT TACTGAAGTT TAGACCATTA CTAATTCGTA GAGAATTCCA ATTGGCTTTG ATTTATATTT AGTTTAGCTA
CTTTATGTCT TGAAATTGAG TTTAGATCTT CTACGGCTAA TTTGCTTTCT TGATGTGCTT ACATTTGACT TCACCAGTTA
GCTAAGAAAG TGCTTCTACG TTATCAAGTA GTAATTTGCC AAGAAGAAAA ACAGCACCCC CTGCAGCAGC CACCCATGGC
TTTTGTGTTA GTCAACCCAT ACATTTTTTA GTTTGTAATG TCAAACTGCC TACTAGATGT TGGCACTAGA CTACATGTTC
ACCGTTATCC CAAATAAGAT TATTAATGAA CTTAATATTG CTCTTTCATT TATTTTTATT TATACATTTC AGCCTGCTTT
GAATTTTGTA TGAACTTTAC TTCTTACTGT ATTGTAATAG AAAAAAAGGG ACACATTCTG ATTTTCAAGT CTTTGACTTA
TTTTGTCTCA AGTTAATTTG ATTCCTTTTG TTCAAAACAG GCCCAGTTGA ACTTGCAGCT GTTGGTGTAT CTATTGCCGT
GTTTAATCAA GTATCAAGGA TTGCAATATT TCCCCTTGTC AGTGTCACGA CATCATTTGT TGCGGAGGAA GATGCTACAT
CCAGTGACAG AGAAAAATAT GAAATAAATG GCGAGAATGA ATTCAATGTT TCAGACAGTG AAATGGAAGA GCTGGTTTCT
CATGAAGGTA AAACAGTTCT AATCTTCTTT TAAGAAACAT TAGAAATTAA ACAATGCTTA TTTCTTTGAC ACTCAATCTT
GCCACCAGAG GCTAGTGCTG CTCCCAGTAA GTCGTCTTTC GAAACTGACT CAAGTGATGT CAAAATTGAA CATAAGCGGA
AAAACATTCC ATCGGTGTCT ACAGCATTAC TACTTGGTGG GGTGCTCGGC CTTTTACAAG CACTGCTTCT TGTTATTTGC
GCAAAACCTC TCTTAGGCTA CATGGGTGTG AAACAGGTAT ATGTTCCTTC ATACCATTTC CTTTGTGGTA AAATCAATTA
TTTTGTCTAA TCGTAAAGAT GTAAACATCA AGGATTGAGT CATCATTTTT TCCTGTTTTT GAAAAATCTA TCAATGGATG
TTCTTTATCA AAATTTAATA ACTGAGAACT CATCTATTAT TAAGTTTAGC TCTGGATAGT TGGATGTGCA CATATATATT
GTAAGTACGA AGTATCACTA ATGGAACTTA ATTTTTCATG TATATTATGA TCTGAATGAA ATTGTAGCAA CAAACTAGTG
TATTGGTGAG TTTCATCATT AAGGACTTCT ATGATTTTGG TTTTTTAATT CTAGAATACA CTGTTTATTT ATTATTTTTC
ACATCGGAGT CCTTTTTCTA CTGAAATTTT CTGATAGGGC TCTGCAATGT TGATGCCAGC ACTAAAGTAC TTGGTAGTCA
GATCTCTTGG TGCTCCTGCT GTGCTTTTAT CTCTGGCAAT GCAAGGGGTA TTTCGTGGAC TTAAAGATAC AAAGACACCT
CTTTATGCAA CTGGTACAGT ATTTCCTTGA CTGCAGAATG GTGTATGCTG TATATAATCA AACCAAGTGT CTAAAATAAT
GATTATTTAA ACTGTCCCTT CAAAGTCATT CTACTTGTGG TGGAATACTT TAATACTTTC TTTTAAGTTC GCAAAGTTAA
GGCAAGATGA CATGATATGA ACTGGTGGGA TCAAACACTT ATGACCTACC GTACATTATT CATGTAATAA AATGCATGAC
TGTAGAACAT GTGTCTCTTG TAGATGGTAT ATTTAAATGC ATGAGATGTT ACGATTAGTG AATAATTTGC CTCAGGATAA
TACATATACC TAATGGTGTT AACTCTTTTT ATACCAGTGG CTGGAGATGC AACCAACATA GTTTTGGATC CAATATTTAT
GTTTGTCTTC CAGTATGGTG TCAGTGGTGC AGCAATTGCT CATGTTATAT CACAGTATGT AGCACAATTC TCTCTTATAA
TATCATTGTT TTTTACCCGT GAAGTTGGAT GACAAACTAT GTCCAAAAGT ATATAATACC TTTCTTCTAC CTCTTGTGAT
AGTGTATGGT GGAAAATTCT GCAGATATTT CATTGCATCC ATTCTCTTAT GGAGGTTAAG GCTACATGTT GACCTACTTC
CACCCAGCTT TAAACATATG CAGTTCAGTC GATTCCTTAA AAACGGTAAT TCTTTTCTAA TATTTTTGGG TTCCAACTAA
GACATGGCCC TTTTTTTTTG CCACAAACCA TTTTACAATA CCTGGTCTTC ATAGGATGAT AATTATTAAT ATCCATTTTC
TCGTATGCAT TCTTAGATTT GATTTTTTTC ATTGAAAGTG CATACTTAAT TCAAAACAGC AAATTAACTA TTTATTTCCT
TTTTTACATT TGGGTTATGC CTGCTTGACT TTCACATTGT TTTAGCACAT AATTTCATTC TAAACGCAAG TTGCCCTTGC
TTGTTTCAAT TATTTTACTT GAAACATTTC TGGTTATATA AAACTCGTTC TCACTTTTCA CACTTCAGGT TTCCTATTAC
TTGCCAGAGT TATTGCTGCA ACATGCTGCG TGACACTATC TGCATCAATG GCTGCACGGC TAGGTTCAGT TCCAATGGCT
GCATTTCAGA TTTGCTTGCA GATCTGGCTG GCTTCGTCTC TTCTTGCTGA TGGATTGGCT TTTGCAGGAC AGGTAAGGGA
ACAGTTGTCT CCACTCACTC CAATGCTGAC AATACTGAAG GTTTCTATTG AACCTTCATT TTAATGAAAA ATTCTACCTC
AGTAACTGCA CCAAAGGGTA TATAATTGAG TTTTCTAAAT TATCTAACGT TGGAAACAGA TAATGAGATG TATCAGCATG
AACTGAAATG AATTTGCATT TTGTTCTTAT GCATCTGGAT CATATTTTGA CAGGCTATAC TTGCAAGTGC ATTTGCTCGT
CAAGACCATT CTAAGGCCGC AGCCACAGCT TCTCGTATAT TGCAGCTGGG ATTGGTTTTA GGACTTCTCC TAAGCATTTT
TCTTGGCATT GGCCTCCGTT TAGGATCAAG GTTATTTACT GATGACCAGG ATGTTCTACA TCATATTTAC CTAGGCATAC
CGGTAAACTT TCTTTATACT GATGCCAAAA TAATTACAAT TTTAAGTCAT ATTGTAGTTA GGATTCCTCA GTTGTGTGCG
GGAGCCTGAT GTTCCTTTAT GATATCTTTC CTACTGTGCA TTGGGATGCC TGCCTACTGT CAGAGTTACC TGGAATTTTT
TTAACTAAAG AGTTATTTTT CCTGTTCAGT TTGTCTCTCT GACTCAACCA ATCAATGCGT TAGCTTTTGT TTTTGATGGT
ATCAATTATG GAGCATCAGA TTTTGGATAT GCTGCTTATT CAATGGCAAG TCAACTAGTC AACACCTATG TCCTTCTATC
TGTATTTTCA ATCCTTTTTT TTTCACATAT TTTTGTTGAA TTCATTGTCC TCAGATTCTT GTGGCAATTG TCAGCATCAT
CTTCATAGTC ACACTAGCAA GTTACAATGG TTTTGTCGGA ATTTGGATAG CTTTGACAGT CTACATGAGC CTCCGAATGC
TTGCAGGATT CTTAAGGTAC AATCAGTCAA AGCATTATCT TTTCTAACCT GAGTATTTGA TTACAAACCT TTATTACAAT
GACAAACAAT AGTTATAAGT CTTCAGTAAT GATTGCTACA ACCAGAATCA CCACCAAACA GTTCACAGGA CACCACTACA
CCAGCTTTCT CCCAGTCTGC ACAGGCACAC ACCCTAAAAG CTAACATTCC ATAGGGAACA TCACAATCTG GCAATTCATG
GTCAGGAATA AATTCACATT GACAGGATCA ACACCACCCT GTGATAAGGA ACATCAATAA GACGTGCAGC CACTAGTCTC
GTGCCCTCGC CATGCCCTTC CCCCATGGCT AAAACAGAAA CCACTTTGCT CTAGCATCTA TCAACTCGAA TGAGAATAGA
TGCTATCATG ATGAGGACCA ATACGAGTAA CAGCAAGCAT CATACCCCAG CTTTAGAGCT CAACACCAAG GAAGAAAAGT
TGCTGATTAT AAGAAGTGAT TTGTGTCAAC GTGCACTTGG CAAATAAAAG AGGTAGCTAG AATGTAGTAA TGTATCCCCG
TGAGGCCGTG ACAGACGAAG CAAGAAAAAT ACCAAAACTT TGTGCTATAT GCCTACAAAT GTAGTTTCAT CTCAAATACG
AAAATAAAAA CTTAAATTCG TTTTATACCT ACTGCAGTGT CATTCGTTTT CTATATTGAT TTTACAAGTT TGCAATAAAT
CGCTATACTA AATTTTCAGG ATAGGGACTG CACGAGGACC ATGGACTTTC TATGCAGCTC AACGCATGCA TTCTCATGAG
GTGGTTGGAC TTTGTTGAAC AATACTATAG GAAGACACCA TGGATACTTT GTAAGGTTTT GCAGGTTTGG TGGGAATGGA
GGTTGTTTGA ACAAAAGAAA ATATTCAACT GTCATGTACA TAGATAATCA CACATGTTAC TACTATTCTA ATAGATTCTC
CCCTGTCGTG TATGTTGTAT TTGCCCATGT ATAGTTCAGT ATGTTCGGCT GGCTATTTTG TAACAAGTTT GGATATAAAG
TCACGTAGCA TAAGATGTTT GCACACCGTG AGATATACGG AGCATTGGCA TTTGATTTTT AAAACATTAA TGGAAATTTT
ACCAGATGCC