Os10t0206800-02

Locus

Os10g0206800

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFRDL2

Oryzabase Gene Name Synonym(s)

FRD3-like protein 2

Transcript Evidence

AK072077 (DDBJ, Best hit)

Protein Evidence

D2CYA4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: drug transmembrane transport (GO:0006855)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Molecular Function: drug transmembrane transporter activity (GO:0015238)

Molecular Function: antiporter activity (GO:0015297)

Functional domain (InterPro)

Multi antimicrobial extrusion protein (IPR002528)

Full-length cDNA

J013116K24 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0206800-02)

RiceXPro (AK072077)

Others

Oryzabase (11140)

KEGG (Os10t0206800-02)

Transcript

1821 bp

>Os10t0206800-02 Similar to predicted protein.
ATCTATTTATCTCTGAGTTTTTATTTTCTTGGGGGTCCTGTTGCAGGTTGGCGTTCAGGT
GGGACGAGCTCGGGAGGGAGATCATGGGGATTGCGGTGCCCGGCGCGCTCGCCCTCATGG
CTGACCCGGTCGCCTCGCTCGTCGACACCGCCTTCATTGGCCACATAGGCCCAGTTGAAC
TTGCAGCTGTTGGTGTATCTATTGCCGTGTTTAATCAAGTATCAAGGATTGCAATATTTC
CCCTTGTCAGTGTCACGACATCATTTGTTGCGGAGGAAGATGCTACATCCAGTGACAGAG
AAAAATATGAAATAAATGGCGAGAATGAATTCAATGTTTCAGACAGTGAAATGGAAGAGC
TGGTTTCTCATGAAGAGGCTAGTGCTGCTCCCAGTAAGTCGTCTTTCGAAACTGACTCAA
GTGATGTCAAAATTGAACATAAGCGGAAAAACATTCCATCGGTGTCTACAGCATTACTAC
TTGGTGGGGTGCTCGGCCTTTTACAAGCACTGCTTCTTGTTATTTGCGCAAAACCTCTCT
TAGGCTACATGGGTGTGAAACAGGGCTCTGCAATGTTGATGCCAGCACTAAAGTACTTGG
TAGTCAGATCTCTTGGTGCTCCTGCTGTGCTTTTATCTCTGGCAATGCAAGGGGTATTTC
GTGGACTTAAAGATACAAAGACACCTCTTTATGCAACTGTGGCTGGAGATGCAACCAACA
TAGTTTTGGATCCAATATTTATGTTTGTCTTCCAGTATGGTGTCAGTGGTGCAGCAATTG
CTCATGTTATATCACATGTATGGTGGAAAATTCTGCAGATATTTCATTGCATCCATTCTC
TTATGGAGGTTAAGGCTACATGTTGACCTACTTCCACCCAGCTTTAAACATATGCAGTTC
AGTCGATTCCTTAAAAACGGTTTCCTATTACTTGCCAGAGTTATTGCTGCAACATGCTGC
GTGACACTATCTGCATCAATGGCTGCACGGCTAGGTTCAGTTCCAATGGCTGCATTTCAG
ATTTGCTTGCAGATCTGGCTGGCTTCGTCTCTTCTTGCTGATGGATTGGCTTTTGCAGGA
CAGGCTATACTTGCAAGTGCATTTGCTCGTCAAGACCATTCTAAGGCCGCAGCCACAGCT
TCTCGTATATTGCAGCTGGGATTGGTTTTAGGACTTCTCCTAAGCATTTTTCTTGGCATT
GGCCTCCGTTTAGGATCAAGGTTATTTACTGATGACCAGGATGTTCTACATCATATTTAC
CTAGGCATACCGTTTGTCTCTCTGACTCAACCAATCAATGCGTTAGCTTTTGTTTTTGAT
GGTATCAATTATGGAGCATCAGATTTTGGATATGCTGCTTATTCAATGATTCTTGTGGCA
ATTGTCAGCATCATCTTCATAGTCACACTAGCAAGTTACAATGGTTTTGTCGGAATTTGG
ATAGCTTTGACAGTCTACATGAGCCTCCGAATGCTTGCAGGATTCTTAAGGATAGGGACT
GCACGAGGACCATGGACTTTCTATGCAGCTCAACGCATGCATTCTCATGAGGTGGTTGGA
CTTTGTTGAACAATACTATAGGAAGACACCATGGATACTTTGTAAGGTTTTGCAGGTTTG
GTGGGAATGGAGGTTGTTTGAACAAAAGAAAATATTCAACTGTCATGTACATAGATAATC
ACACATGTTACTACTATTCTAATAGATTCTCCCCTGTCGTGTATGTTGTATTTGCCCATG
TATAGTTCAGTATGTTCGGCTGGCTATTTTGTAACAAGTTTGGATATAAAGTCACGTAGC
ATAAGATGTTTGCACACCGTG

CDS

864 bp

>Os10t0206800-02 Similar to predicted protein.
CTATTTATCTCTGAGTTTTTATTTTCTTGGGGGTCCTGTTGCAGGTTGGCGTTCAGGTGG
GACGAGCTCGGGAGGGAGATCATGGGGATTGCGGTGCCCGGCGCGCTCGCCCTCATGGCT
GACCCGGTCGCCTCGCTCGTCGACACCGCCTTCATTGGCCACATAGGCCCAGTTGAACTT
GCAGCTGTTGGTGTATCTATTGCCGTGTTTAATCAAGTATCAAGGATTGCAATATTTCCC
CTTGTCAGTGTCACGACATCATTTGTTGCGGAGGAAGATGCTACATCCAGTGACAGAGAA
AAATATGAAATAAATGGCGAGAATGAATTCAATGTTTCAGACAGTGAAATGGAAGAGCTG
GTTTCTCATGAAGAGGCTAGTGCTGCTCCCAGTAAGTCGTCTTTCGAAACTGACTCAAGT
GATGTCAAAATTGAACATAAGCGGAAAAACATTCCATCGGTGTCTACAGCATTACTACTT
GGTGGGGTGCTCGGCCTTTTACAAGCACTGCTTCTTGTTATTTGCGCAAAACCTCTCTTA
GGCTACATGGGTGTGAAACAGGGCTCTGCAATGTTGATGCCAGCACTAAAGTACTTGGTA
GTCAGATCTCTTGGTGCTCCTGCTGTGCTTTTATCTCTGGCAATGCAAGGGGTATTTCGT
GGACTTAAAGATACAAAGACACCTCTTTATGCAACTGTGGCTGGAGATGCAACCAACATA
GTTTTGGATCCAATATTTATGTTTGTCTTCCAGTATGGTGTCAGTGGTGCAGCAATTGCT
CATGTTATATCACATGTATGGTGGAAAATTCTGCAGATATTTCATTGCATCCATTCTCTT
ATGGAGGTTAAGGCTACATGTTGA

Protein

288 aa

>Os10t0206800-02 Similar to predicted protein.
LFISEFLFSWGSCCRLAFRWDELGREIMGIAVPGALALMADPVASLVDTAFIGHIGPVEL
AAVGVSIAVFNQVSRIAIFPLVSVTTSFVAEEDATSSDREKYEINGENEFNVSDSEMEEL
VSHEEASAAPSKSSFETDSSDVKIEHKRKNIPSVSTALLLGGVLGLLQALLLVICAKPLL
GYMGVKQGSAMLMPALKYLVVRSLGAPAVLLSLAMQGVFRGLKDTKTPLYATVAGDATNI
VLDPIFMFVFQYGVSGAAIAHVISHVWWKILQIFHCIHSLMEVKATC*

5'UTR

chr10:7574319..7574320 (+ strand) : 2 bp

CDS

chr10:7574321..7574486 (+ strand) : 166 bp

chr10:7575678..7575884 (+ strand) : 207 bp

chr10:7575966..7576153 (+ strand) : 188 bp

chr10:7576555..7576690 (+ strand) : 136 bp

chr10:7577035..7577131 (+ strand) : 97 bp

chr10:7577240..7577309 (+ strand) : 70 bp

3'UTR

chr10:7577310..7577362 (+ strand) : 53 bp

chr10:7577706..7577869 (+ strand) : 164 bp

chr10:7578091..7578279 (+ strand) : 189 bp

chr10:7578467..7578561 (+ strand) : 95 bp

chr10:7578651..7578773 (+ strand) : 123 bp

chr10:7579497..7579827 (+ strand) : 331 bp

FASTA

>Os10t0206800-02 class=Sequence position=chr10:7574319..7579827 (+ strand)
ATCTATTTAT CTCTGAGTTT TTATTTTCTT GGGGGTCCTG TTGCAGGTTG GCGTTCAGGT GGGACGAGCT CGGGAGGGAG
ATCATGGGGA TTGCGGTGCC CGGCGCGCTC GCCCTCATGG CTGACCCGGT CGCCTCGCTC GTCGACACCG CCTTCATTGG
CCACATAGGT TTGCTTCTCT TCTCTCCTTA TTTTCCTTAT TTTTTTTAAT TTTTTCCCCT TACTGCTGAC TTCGTTGTGA
AGTTTCCACC ACCAGTTCTG ACCTGCTCCA GGTGGGATTG GAACGTACTC TGTTCTACCC TTCGGCCTTG GTCGCACGAT
GTAATTTTAA TACTACTAGA TTTCTTTTCA GCTTGGAGCA AACCTAACCC AGTTCATTCC GTTAGTGGTA GGAATTAAGG
TGTGGTGTTT GGTCCTGACT ATTACGAAAT TTATCTGGCT GTGCTGGTAA TAGATCTCGC TTCCATAATG TCGAACCTAA
AAAAATGAAG CAGTAGTTTG TAAAGTAGTA GAGTCTTTTG CCGACATCGT GGCTGATGGT TGCCATTGTT TAGAATATTG
ATACTAACCC TAATATTTCA TTGCTAAGTA TTAAAACAAA ATTTTAATGC TTTCAATTCA AGGGTTAGTG TGTAGTTATG
TAGTACGGTG CCCTTAAATG TCTTAACATC AAAGTTGATT GTCAGATAGG TTTTTTATTG ATGAATTCTG TAAGAAAGCA
ATCAAAAAGC ATAAAGTTGG ATAATGACCA TTGTTTAAGG TCAACGCAAA CTGGCCATAT TTTATATTCA GCAAGTATGT
ATGGTAATAC TAATGAATCA ATGTCATGTA AAATAGATGT AGAATTAATT ACTGAAGTTT AGACCATTAC TAATTCGTAG
AGAATTCCAA TTGGCTTTGA TTTATATTTA GTTTAGCTAC TTTATGTCTT GAAATTGAGT TTAGATCTTC TACGGCTAAT
TTGCTTTCTT GATGTGCTTA CATTTGACTT CACCAGTTAG CTAAGAAAGT GCTTCTACGT TATCAAGTAG TAATTTGCCA
AGAAGAAAAA CAGCACCCCC TGCAGCAGCC ACCCATGGCT TTTGTGTTAG TCAACCCATA CATTTTTTAG TTTGTAATGT
CAAACTGCCT ACTAGATGTT GGCACTAGAC TACATGTTCA CCGTTATCCC AAATAAGATT ATTAATGAAC TTAATATTGC
TCTTTCATTT ATTTTTATTT ATACATTTCA GCCTGCTTTG AATTTTGTAT GAACTTTACT TCTTACTGTA TTGTAATAGA
AAAAAAGGGA CACATTCTGA TTTTCAAGTC TTTGACTTAT TTTGTCTCAA GTTAATTTGA TTCCTTTTGT TCAAAACAGG
CCCAGTTGAA CTTGCAGCTG TTGGTGTATC TATTGCCGTG TTTAATCAAG TATCAAGGAT TGCAATATTT CCCCTTGTCA
GTGTCACGAC ATCATTTGTT GCGGAGGAAG ATGCTACATC CAGTGACAGA GAAAAATATG AAATAAATGG CGAGAATGAA
TTCAATGTTT CAGACAGTGA AATGGAAGAG CTGGTTTCTC ATGAAGGTAA AACAGTTCTA ATCTTCTTTT AAGAAACATT
AGAAATTAAA CAATGCTTAT TTCTTTGACA CTCAATCTTG CCACCAGAGG CTAGTGCTGC TCCCAGTAAG TCGTCTTTCG
AAACTGACTC AAGTGATGTC AAAATTGAAC ATAAGCGGAA AAACATTCCA TCGGTGTCTA CAGCATTACT ACTTGGTGGG
GTGCTCGGCC TTTTACAAGC ACTGCTTCTT GTTATTTGCG CAAAACCTCT CTTAGGCTAC ATGGGTGTGA AACAGGTATA
TGTTCCTTCA TACCATTTCC TTTGTGGTAA AATCAATTAT TTTGTCTAAT CGTAAAGATG TAAACATCAA GGATTGAGTC
ATCATTTTTT CCTGTTTTTG AAAAATCTAT CAATGGATGT TCTTTATCAA AATTTAATAA CTGAGAACTC ATCTATTATT
AAGTTTAGCT CTGGATAGTT GGATGTGCAC ATATATATTG TAAGTACGAA GTATCACTAA TGGAACTTAA TTTTTCATGT
ATATTATGAT CTGAATGAAA TTGTAGCAAC AAACTAGTGT ATTGGTGAGT TTCATCATTA AGGACTTCTA TGATTTTGGT
TTTTTAATTC TAGAATACAC TGTTTATTTA TTATTTTTCA CATCGGAGTC CTTTTTCTAC TGAAATTTTC TGATAGGGCT
CTGCAATGTT GATGCCAGCA CTAAAGTACT TGGTAGTCAG ATCTCTTGGT GCTCCTGCTG TGCTTTTATC TCTGGCAATG
CAAGGGGTAT TTCGTGGACT TAAAGATACA AAGACACCTC TTTATGCAAC TGGTACAGTA TTTCCTTGAC TGCAGAATGG
TGTATGCTGT ATATAATCAA ACCAAGTGTC TAAAATAATG ATTATTTAAA CTGTCCCTTC AAAGTCATTC TACTTGTGGT
GGAATACTTT AATACTTTCT TTTAAGTTCG CAAAGTTAAG GCAAGATGAC ATGATATGAA CTGGTGGGAT CAAACACTTA
TGACCTACCG TACATTATTC ATGTAATAAA ATGCATGACT GTAGAACATG TGTCTCTTGT AGATGGTATA TTTAAATGCA
TGAGATGTTA CGATTAGTGA ATAATTTGCC TCAGGATAAT ACATATACCT AATGGTGTTA ACTCTTTTTA TACCAGTGGC
TGGAGATGCA ACCAACATAG TTTTGGATCC AATATTTATG TTTGTCTTCC AGTATGGTGT CAGTGGTGCA GCAATTGCTC
ATGTTATATC ACAGTATGTA GCACAATTCT CTCTTATAAT ATCATTGTTT TTTACCCGTG AAGTTGGATG ACAAACTATG
TCCAAAAGTA TATAATACCT TTCTTCTACC TCTTGTGATA GTGTATGGTG GAAAATTCTG CAGATATTTC ATTGCATCCA
TTCTCTTATG GAGGTTAAGG CTACATGTTG ACCTACTTCC ACCCAGCTTT AAACATATGC AGTTCAGTCG ATTCCTTAAA
AACGGTAATT CTTTTCTAAT ATTTTTGGGT TCCAACTAAG ACATGGCCCT TTTTTTTTGC CACAAACCAT TTTACAATAC
CTGGTCTTCA TAGGATGATA ATTATTAATA TCCATTTTCT CGTATGCATT CTTAGATTTG ATTTTTTTCA TTGAAAGTGC
ATACTTAATT CAAAACAGCA AATTAACTAT TTATTTCCTT TTTTACATTT GGGTTATGCC TGCTTGACTT TCACATTGTT
TTAGCACATA ATTTCATTCT AAACGCAAGT TGCCCTTGCT TGTTTCAATT ATTTTACTTG AAACATTTCT GGTTATATAA
AACTCGTTCT CACTTTTCAC ACTTCAGGTT TCCTATTACT TGCCAGAGTT ATTGCTGCAA CATGCTGCGT GACACTATCT
GCATCAATGG CTGCACGGCT AGGTTCAGTT CCAATGGCTG CATTTCAGAT TTGCTTGCAG ATCTGGCTGG CTTCGTCTCT
TCTTGCTGAT GGATTGGCTT TTGCAGGACA GGTAAGGGAA CAGTTGTCTC CACTCACTCC AATGCTGACA ATACTGAAGG
TTTCTATTGA ACCTTCATTT TAATGAAAAA TTCTACCTCA GTAACTGCAC CAAAGGGTAT ATAATTGAGT TTTCTAAATT
ATCTAACGTT GGAAACAGAT AATGAGATGT ATCAGCATGA ACTGAAATGA ATTTGCATTT TGTTCTTATG CATCTGGATC
ATATTTTGAC AGGCTATACT TGCAAGTGCA TTTGCTCGTC AAGACCATTC TAAGGCCGCA GCCACAGCTT CTCGTATATT
GCAGCTGGGA TTGGTTTTAG GACTTCTCCT AAGCATTTTT CTTGGCATTG GCCTCCGTTT AGGATCAAGG TTATTTACTG
ATGACCAGGA TGTTCTACAT CATATTTACC TAGGCATACC GGTAAACTTT CTTTATACTG ATGCCAAAAT AATTACAATT
TTAAGTCATA TTGTAGTTAG GATTCCTCAG TTGTGTGCGG GAGCCTGATG TTCCTTTATG ATATCTTTCC TACTGTGCAT
TGGGATGCCT GCCTACTGTC AGAGTTACCT GGAATTTTTT TAACTAAAGA GTTATTTTTC CTGTTCAGTT TGTCTCTCTG
ACTCAACCAA TCAATGCGTT AGCTTTTGTT TTTGATGGTA TCAATTATGG AGCATCAGAT TTTGGATATG CTGCTTATTC
AATGGCAAGT CAACTAGTCA ACACCTATGT CCTTCTATCT GTATTTTCAA TCCTTTTTTT TTCACATATT TTTGTTGAAT
TCATTGTCCT CAGATTCTTG TGGCAATTGT CAGCATCATC TTCATAGTCA CACTAGCAAG TTACAATGGT TTTGTCGGAA
TTTGGATAGC TTTGACAGTC TACATGAGCC TCCGAATGCT TGCAGGATTC TTAAGGTACA ATCAGTCAAA GCATTATCTT
TTCTAACCTG AGTATTTGAT TACAAACCTT TATTACAATG ACAAACAATA GTTATAAGTC TTCAGTAATG ATTGCTACAA
CCAGAATCAC CACCAAACAG TTCACAGGAC ACCACTACAC CAGCTTTCTC CCAGTCTGCA CAGGCACACA CCCTAAAAGC
TAACATTCCA TAGGGAACAT CACAATCTGG CAATTCATGG TCAGGAATAA ATTCACATTG ACAGGATCAA CACCACCCTG
TGATAAGGAA CATCAATAAG ACGTGCAGCC ACTAGTCTCG TGCCCTCGCC ATGCCCTTCC CCCATGGCTA AAACAGAAAC
CACTTTGCTC TAGCATCTAT CAACTCGAAT GAGAATAGAT GCTATCATGA TGAGGACCAA TACGAGTAAC AGCAAGCATC
ATACCCCAGC TTTAGAGCTC AACACCAAGG AAGAAAAGTT GCTGATTATA AGAAGTGATT TGTGTCAACG TGCACTTGGC
AAATAAAAGA GGTAGCTAGA ATGTAGTAAT GTATCCCCGT GAGGCCGTGA CAGACGAAGC AAGAAAAATA CCAAAACTTT
GTGCTATATG CCTACAAATG TAGTTTCATC TCAAATACGA AAATAAAAAC TTAAATTCGT TTTATACCTA CTGCAGTGTC
ATTCGTTTTC TATATTGATT TTACAAGTTT GCAATAAATC GCTATACTAA ATTTTCAGGA TAGGGACTGC ACGAGGACCA
TGGACTTTCT ATGCAGCTCA ACGCATGCAT TCTCATGAGG TGGTTGGACT TTGTTGAACA ATACTATAGG AAGACACCAT
GGATACTTTG TAAGGTTTTG CAGGTTTGGT GGGAATGGAG GTTGTTTGAA CAAAAGAAAA TATTCAACTG TCATGTACAT
AGATAATCAC ACATGTTACT ACTATTCTAA TAGATTCTCC CCTGTCGTGT ATGTTGTATT TGCCCATGTA TAGTTCAGTA
TGTTCGGCTG GCTATTTTGT AACAAGTTTG GATATAAAGT CACGTAGCAT AAGATGTTTG CACACCGTG