Os10t0359500-01

Locus

Os10g0359500

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC61

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 61

Oryzabase Gene Symbol Synonym(s)

ONAC061, ONAC61

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 061, NAC domain-containing protein 61

Transcript Evidence

AK072682 (DDBJ, Best hit)

Protein Evidence

Q339G0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J023135B15 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0359500-01)

RiceXPro (AK072682)

Others

Oryzabase (11490)

KEGG (Os10t0359500-01)

Transcript

1854 bp

>Os10t0359500-01 No apical meristem (NAM) protein domain containing protein.
ACCCGCTCGCGCAATTCGCACGCTCTCCTCGCCTCGCCTCGCCTTCTCTTCTCTCCTCAC
CTCGCCCGCGTCGTCGTCGTCGTCGTCTCCGCGGCGGCGGGGGAAGCAGCGGGAGGCGGA
GGCGGAGCAGCAGCAGCACCACCACCCCGGGGCGGGGCCGCGGCGCGGTGCTCGCGCGCG
TCGACTCCGTGTGGACAATCATGTCTTCTAAAGTTCCTGGGTTAGCATTACTTAACACCA
GCATAAGCAAATTTTGGAGCGATGAGGAGCTTGTCCGATTCTTAGCAGAGAGGAAAGAAG
CACACTCTCTGCCAGAGAATGTATTTGTGGGAATGAACATTTCTCTCATTGATCCACGTA
ACTCAGAGGACATATGGTACATGAATTTTTCAGATGATCCACAATCCCCTAAGAATGGAG
AAAATGCTATTATAAAGTCAAAAACCGGATACTGGAAAGTTGTTGGCACTGTTAGAATAC
CGACAAGTACTGTTATTGTGGGTATGAAAGTTTCTCTGGACCATTATGAAGGCGAAGCAC
CATCTGGTAAGAGAACTGGGTGGGTGATGGATGAATATCTGATTGAACAGAATGACGAAG
CTAATCTACCACAGGACTACAAGAATTTGTGTACAATATTCTTTCAGGGAGACGACATAT
TAAATGCTGGAGATAAGCAGATATGTCTGAATGCAAATGTTCCTAATGAACGCAAGGAAT
TTTACCTTCAATATCTTGCTGAACTAGAAGAGCAAAATGCTGCATGGAGCAACCAGGCTG
TATCTGTAAACGAGCAAGATGTCTCTTCCAGCAAAGGACTGGACGGGCAAAAAACTAGTG
CTGCTGATGACCAATCTGTTAATCATGCCCCTTCTAGGGAGGGCTACATAGAATTGAATG
ACTTCTTAAACTCAGATTCGTCCGCATCAACTTCGGAATACTCAAGTCAACGCACTATGA
TTTCTGAAGAGTACTTCGATTCTGATGCATTTCTGAGGGAGATTAGGAATGACCATAACG
CAGCTGATGAAGAACATACAGACAGCAAGTTCAGCGTAGCTGCAGCTAGTAAATCAGATT
GCGTGGTTATCAGTCCACCTGAACAAGGGTTTGTTAACAATCTCGATAACCATGCCACCA
TAGCTGGAGATTCACCGCAAAAGTCAGTGAAAAATGATAAAGTAGACGAACACTCAAGTG
AGGAGCATCCACAGCACAGTCCTACAACTTCCTGTTTCCCAAGTCATGTGAAACGAAGCC
TTTCTAGTAGTTCCAGTAGCTCTCAGGGTACCAGCAACAGCAAGTCTCCCCAGAGACAGA
GAGAGCGATCTACCAAAAAAATTGGAAAATTAGGAAAGTACTGGTGTTGTGGATCATTAT
AGTCCATTGCATAGCATTTCTATACTCTGTACAGGAAGCATGACATTACGCCATGCTATT
TTGATACGGACTGGTCGCCTCAACAGATTTATGCCAGATCTTCTGATAGAACATAGTCAA
AGAAGACTGCAAGTTTTGAAGCAACAATGACCAACAATACTACAAACTGTGGAAAGTTAC
ATTTTTGTTTTGTTCATAGTGTGAAGATATCATGACCTTGATGATTCTGTCAAACTGAAG
TGAGCTACCTTGATTCCATTCTTGATTGATAGGGTCAGATATTCACTGATACCTGTGTTA
GTTCAGTGAAATGAGGATGGCAGTAGTTTCTGATTATCACCAGGTGCTCTCATTTGTAAA
CATCTACAGTACAGTTTCATATGATAGAATTTCACATTTTAGTAAGTACTAATACTGATT
GCTCAATACTTAGTTATCCTGCTTGCATTTGAAGGAGTATAAGCTTTTGATTTA

CDS

1182 bp

>Os10t0359500-01 No apical meristem (NAM) protein domain containing protein.
ATGTCTTCTAAAGTTCCTGGGTTAGCATTACTTAACACCAGCATAAGCAAATTTTGGAGC
GATGAGGAGCTTGTCCGATTCTTAGCAGAGAGGAAAGAAGCACACTCTCTGCCAGAGAAT
GTATTTGTGGGAATGAACATTTCTCTCATTGATCCACGTAACTCAGAGGACATATGGTAC
ATGAATTTTTCAGATGATCCACAATCCCCTAAGAATGGAGAAAATGCTATTATAAAGTCA
AAAACCGGATACTGGAAAGTTGTTGGCACTGTTAGAATACCGACAAGTACTGTTATTGTG
GGTATGAAAGTTTCTCTGGACCATTATGAAGGCGAAGCACCATCTGGTAAGAGAACTGGG
TGGGTGATGGATGAATATCTGATTGAACAGAATGACGAAGCTAATCTACCACAGGACTAC
AAGAATTTGTGTACAATATTCTTTCAGGGAGACGACATATTAAATGCTGGAGATAAGCAG
ATATGTCTGAATGCAAATGTTCCTAATGAACGCAAGGAATTTTACCTTCAATATCTTGCT
GAACTAGAAGAGCAAAATGCTGCATGGAGCAACCAGGCTGTATCTGTAAACGAGCAAGAT
GTCTCTTCCAGCAAAGGACTGGACGGGCAAAAAACTAGTGCTGCTGATGACCAATCTGTT
AATCATGCCCCTTCTAGGGAGGGCTACATAGAATTGAATGACTTCTTAAACTCAGATTCG
TCCGCATCAACTTCGGAATACTCAAGTCAACGCACTATGATTTCTGAAGAGTACTTCGAT
TCTGATGCATTTCTGAGGGAGATTAGGAATGACCATAACGCAGCTGATGAAGAACATACA
GACAGCAAGTTCAGCGTAGCTGCAGCTAGTAAATCAGATTGCGTGGTTATCAGTCCACCT
GAACAAGGGTTTGTTAACAATCTCGATAACCATGCCACCATAGCTGGAGATTCACCGCAA
AAGTCAGTGAAAAATGATAAAGTAGACGAACACTCAAGTGAGGAGCATCCACAGCACAGT
CCTACAACTTCCTGTTTCCCAAGTCATGTGAAACGAAGCCTTTCTAGTAGTTCCAGTAGC
TCTCAGGGTACCAGCAACAGCAAGTCTCCCCAGAGACAGAGAGAGCGATCTACCAAAAAA
ATTGGAAAATTAGGAAAGTACTGGTGTTGTGGATCATTATAG

Protein

394 aa

>Os10t0359500-01 No apical meristem (NAM) protein domain containing protein.
MSSKVPGLALLNTSISKFWSDEELVRFLAERKEAHSLPENVFVGMNISLIDPRNSEDIWY
MNFSDDPQSPKNGENAIIKSKTGYWKVVGTVRIPTSTVIVGMKVSLDHYEGEAPSGKRTG
WVMDEYLIEQNDEANLPQDYKNLCTIFFQGDDILNAGDKQICLNANVPNERKEFYLQYLA
ELEEQNAAWSNQAVSVNEQDVSSSKGLDGQKTSAADDQSVNHAPSREGYIELNDFLNSDS
SASTSEYSSQRTMISEEYFDSDAFLREIRNDHNAADEEHTDSKFSVAAASKSDCVVISPP
EQGFVNNLDNHATIAGDSPQKSVKNDKVDEHSSEEHPQHSPTTSCFPSHVKRSLSSSSSS
SQGTSNSKSPQRQRERSTKKIGKLGKYWCCGSL*

5'UTR

chr10:11040404..11040596 (- strand) : 193 bp

chr10:11039310..11039316 (- strand) : 7 bp

CDS

chr10:11039144..11039309 (- strand) : 166 bp

chr10:11037798..11038045 (- strand) : 248 bp

chr10:11037540..11037701 (- strand) : 162 bp

chr10:11036863..11037193 (- strand) : 331 bp

chr10:11036148..11036422 (- strand) : 275 bp

3'UTR

chr10:11035676..11036147 (- strand) : 472 bp

FASTA

>Os10t0359500-01 class=Sequence position=chr10:11035676..11040596 (- strand)
ACCCGCTCGC GCAATTCGCA CGCTCTCCTC GCCTCGCCTC GCCTTCTCTT CTCTCCTCAC CTCGCCCGCG TCGTCGTCGT
CGTCGTCTCC GCGGCGGCGG GGGAAGCAGC GGGAGGCGGA GGCGGAGCAG CAGCAGCACC ACCACCCCGG GGCGGGGCCG
CGGCGCGGTG CTCGCGCGCG TCGACTCCGT GTGGTGCGCG AATCGTCCTC TCCGCTTTAC TCTTGGGTTC GTCATTTCGG
TGGGCGGATG CGGGTGGGTT GGATTCGGTG TGGTTCGTGG GGGGTGGGGA TTCGGATCGG GGGTGATTTT GAGAGGGGGG
GATCGGGTTC TTGATTCGAG GTGCGATTCG GGAATCGGGA GTTGGAGCGG GGGAGGGGGA GGAATATTTC GTGTGGGGTT
TGTGCGCGAT TCTCCCCGTC GCTTTTGGGG TACCATCCAG GGGACGAGGG AGTCGTTTGA TATGGTCGCG TTCATGCTTC
TATTTTTGGG TGGCGATCTC CTGTAAAATT TGGACCCGGA TTCGGGGTGG TTCTGTTTGT GGTCGAGTTT TCCTCGATTT
GATTGCTGAG CGGAATATTT TGTTGGGTGT TCTTGAATTT TTTTTTTTGC GTCTTATGTG GTTGATTGGT TTGCGATTCT
TCATTAGTTT ATCTTCGCCG CGTTTGTGTA AATGTGGGTA ATGTAAAGAA CAAAAAAAAA ATTCAGGGAC TAAAATTAGT
GTGTTCTGTT ATGGCTTCAG CGTTGCTGGT CTGCAGCTGC TGCGGAAGTA GTAATAGATG AGGAAATGCC CACCGATTTT
TCCAGATTGT TTGATTTCTT CTTGCCCTGT TGTTGTGGCC TTGATAAGAT CCGGTTATGG CTACTTATTT TATTCTTTTA
TGCCGTTTAA ATCAATTAGT TCATGTATCT TTGCTGTACA AATTGTGTGT TATCATTTTG AGTTGTGGCA TTTTGTCAGT
CCAAGATTCC CTGAGACAAC GAACCTTACT AATGATGGCG GTGAGCAGCT ACTGAGCTCT GCGTTTGCTT TACCTGATAG
TGCTTAATTT GGCAATTGTT AGCTCTGCAT AGTGCTACTG TACACGTGGT AGTGTTCAGT TTTGGTAGGA AGAGCACTAA
ATTTAAGTAC TGCTATGTAT CAGTTATTTC TTTCAGATTG TTTGACCACA GAACAGATAC GTTTTCATGT TATCAATGCA
CATCCTTTTA GAAATATGCC TTGGTATTTG TATGTCAACT AAAGAAGCAT GTCGGCTAAA ATTGGTTCTA TTTTTTCCAG
GACAATCATG TCTTCTAAAG TTCCTGGGTT AGCATTACTT AACACCAGCA TAAGCAAATT TTGGAGCGAT GAGGAGCTTG
TCCGATTCTT AGCAGAGAGG AAAGAAGCAC ACTCTCTGCC AGAGAATGTA TTTGTGGGAA TGAACATTTC TCTCATTGAT
CCACGTAACT CAGGTTTGCA TCCAATCTAT ACACAGGATA ATTAATGGTA TTTTCCAACA AGATTATGGC ATATGTGGAA
TTTGTGGTCT GACTTTCATA ATTCAGTCAT TATGGACCCT GAAGGCTTCT TTGTTTTGTC CTTTTTGATT TGTTATATAC
TTACTTTACA GCATTGTATT GTATGGTTGA GCAGTATTGC AACATTTTAA TTCTCAATAG ACAACTAAAG AAAATGAATT
CTGCATAGAA TTGATAACTA TTTAGGGTTG AAAGGCATAA ACAATATTTT ATGCAATGCC AGAAAGAAAT ATTTTGAGCT
CTGATGAAAG TGCCATGTTA AGTGCAGGAA CACATACTTC TGCCCCATTG ATTATGGCAC AAATTGCCAG CATGAAGTGC
TCATAAACTA TAGCAGGATG TTATATGAGA AATAGTTTGG CACTTCACAT TAAATTGAGC ATTTTGTTTT TCATTTTTCT
TAGCTTGTGC ACCAATTGCT TGCCTGCTTT TGCTGGAAAA GTATGAAGTA CACTCTTTGA TGATTAAATT CTGTTCACTG
TGTTGCTTGG CTAGAACTTA CTCTGCCATC CTTACTAGAT TCTCCAATTA TGCAAAATCA TTGTTTCCAA GTGAAAATTA
AGTTTTCGAA GATGTCAGAA TTCAGTATAT GCAATTAATT ATCAACTTTT GTTTTTAGTT GGAGTCACTA TACAAGCAGA
TCATGTGCTT AGATTTTGGG GCTTCAGTTC ACTTTCCACA CTAAAATGTG CACCTAAGTT GTTGATATGT GTCTCTGCAC
TCTTCAGTAT CCCACATCAT AACACATAGT ACATAAATCT ACTGGAATCA TATATTAATA ACATTCTTGC ATGTTTTAAA
TTGGTAACTG GTGCCTGGTT TCAATAAAGA TTTGATTGCA AATTTTCTGA GGTATCAGAA CTAAAGTTTA CTCTTTTTTG
CATAGCACAA GTCCACAGTT CACTGTGACC AGCGGTGCTA TATCCTAGAG TTAAGCTATT CCTACAATGA AAACCACAAT
GGTGCTTAAT GGCTTATTAT CTTGTTAAAC CTCAATAAAA GATAATCTGA CAGAGATAAC TTTTCTTGCA GAGGACATAT
GGTACATGAA TTTTTCAGAT GATCCACAAT CCCCTAAGAA TGGAGAAAAT GCTATTATAA AGTCAAAAAC CGGATACTGG
AAAGTTGTTG GCACTGTTAG AATACCGACA AGTACTGTTA TTGTGGGTAT GAAAGTTTCT CTGGACCATT ATGAAGGCGA
AGCACCATCT GGTAAGAGAA CTGGGTGGGT GATGGATGAA TATCTGATTG AACAGAATGA CGAAGCTAAT CTACCACAGG
TAACCCATGG TGGTTGATTG ATATCATTTT TTTTTCTATA GCATATAAGC TTTTTTTCCA GGGTTGTTGA TTGATATCTT
TTGTATTTTT GACAGGACTA CAAGAATTTG TGTACAATAT TCTTTCAGGG AGACGACATA TTAAATGCTG GAGATAAGCA
GATATGTCTG AATGCAAATG TTCCTAATGA ACGCAAGGAA TTTTACCTTC AATATCTTGC TGAACTAGAA GAGCAAAATG
CTGCATGGAG CAACCAGGTT TGTATTGTTT TCTTTATTAT GTAAGGCATC CTTAGCAATA CCCTGGATCT TTTAGTTTTG
CACATATTTT TTCTCATTTT AGTGTAAAGT ATACCTTGAT CCATGATTGT CTGTCATGTA AAATTAAGAA ATACTCCAGC
AATCCTGTCA TTGTAATTCA CTTTTTTATT TTGATTTTGA AGTATTTAAG GTTTTCTCCT TCATAACCAT ACAAAATCTG
TTGTTTGTGA GAGCATGCTC CTATCCGATC ATCATTTACT ACTTATTGCT TTCTTCTGCA TTACAAACTG TGAATATTTA
GATGTGTGAT AATACTAATG AATATCCAAT CTACATATGC CAGGCTGTAT CTGTAAACGA GCAAGATGTC TCTTCCAGCA
AAGGACTGGA CGGGCAAAAA ACTAGTGCTG CTGATGACCA ATCTGTTAAT CATGCCCCTT CTAGGGAGGG CTACATAGAA
TTGAATGACT TCTTAAACTC AGATTCGTCC GCATCAACTT CGGAATACTC AAGTCAACGC ACTATGATTT CTGAAGAGTA
CTTCGATTCT GATGCATTTC TGAGGGAGAT TAGGAATGAC CATAACGCAG CTGATGAAGA ACATACAGAC AGCAAGTTCA
GCGTAGCTGC AGCTAGTAAA TCAGATTGCG TGGTTATCAG TCCACCTGAA CAAGGTAACT TATCCCTTCT GTTGCTAGTT
CCAAAACTAG AGGACGCTAC AAATCTTTGT GTTTGTTCTA GAAAAGTAAG TGTAACAATG CAAACAACCA TTTCAAAGTT
TGTAACCATG AAAATTTGCA AGTAAAAAGC CCAAATGCAA TATACTTCAC ACAAATACTA GAAATCGAGA ACTGTTGATA
ATGCTAATTT TACAGCTGCA CTTGCTCATA TTGATATGCA ATGTTTATTT GTTTGTTTCT TATTGCTACT GGTGAAGTTC
TTGATTAGCA TGCTTGTTCA ACAGTATTGT TTCGCATACG AGTAACATGT AAGTTACTCT TGTCTAGAGA GTTAGATGAT
TACTTTTCAG CTCATTAACT TATTTTATTT ATCTTGTTTA TACAATAATT TGTTAGTAGG ATTTATACTG AAGTTGGCAT
CTCTGTGCGT GCAGGGTTTG TTAACAATCT CGATAACCAT GCCACCATAG CTGGAGATTC ACCGCAAAAG TCAGTGAAAA
ATGATAAAGT AGACGAACAC TCAAGTGAGG AGCATCCACA GCACAGTCCT ACAACTTCCT GTTTCCCAAG TCATGTGAAA
CGAAGCCTTT CTAGTAGTTC CAGTAGCTCT CAGGGTACCA GCAACAGCAA GTCTCCCCAG AGACAGAGAG AGCGATCTAC
CAAAAAAATT GGAAAATTAG GAAAGTACTG GTGTTGTGGA TCATTATAGT CCATTGCATA GCATTTCTAT ACTCTGTACA
GGAAGCATGA CATTACGCCA TGCTATTTTG ATACGGACTG GTCGCCTCAA CAGATTTATG CCAGATCTTC TGATAGAACA
TAGTCAAAGA AGACTGCAAG TTTTGAAGCA ACAATGACCA ACAATACTAC AAACTGTGGA AAGTTACATT TTTGTTTTGT
TCATAGTGTG AAGATATCAT GACCTTGATG ATTCTGTCAA ACTGAAGTGA GCTACCTTGA TTCCATTCTT GATTGATAGG
GTCAGATATT CACTGATACC TGTGTTAGTT CAGTGAAATG AGGATGGCAG TAGTTTCTGA TTATCACCAG GTGCTCTCAT
TTGTAAACAT CTACAGTACA GTTTCATATG ATAGAATTTC ACATTTTAGT AAGTACTAAT ACTGATTGCT CAATACTTAG
TTATCCTGCT TGCATTTGAA GGAGTATAAG CTTTTGATTT A

Locus: Os10g0359500

Loading...

Locus: Os10g0359500

Loading...