Os10t0378300-01

Locus

Os10g0378300

Description

CutA1 protein

RAP-DB Gene Symbol Synonym(s)

OsCutA1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CUTA1

CGSNL Gene Name

CU TOLERANCE A1

Oryzabase Gene Symbol Synonym(s)

OsCutA1

Oryzabase Gene Name Synonym(s)

"Protein CutA 1, chloroplastic"

Transcript Evidence

AK102858

Protein Evidence

Q109R6

Literature

PMID: 18154307

Note

Manual Curation

July 8, 2021

Gene Ontology (GO)

Biological Process: response to metal ion (GO:0010038)

Functional domain (InterPro)

Nitrogen regulatory protein PII/ATP phosphoribosyltransferase, C-terminal (IPR015867)

Nitrogen regulatory PII-like, alpha/beta (IPR011322)

Divalent ion tolerance protein, CutA (IPR004323)

Full-length cDNA

J033110P07 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0378300-01)

RiceXPro (AK102858)

Others

Oryzabase (7181)

KEGG (Os10t0378300-01)

Transcript

781 bp

>Os10t0378300-01 CutA1 protein
TGTAGGCCGAAGCTCCCAGAAGATGCCACTCCTCCCCTCCCCGCTCGGATCTCTCTCCGC
CGCCGCCACCGCCGCCCCACGCCGCGCCGCCGCGGCTGCCGGGCTCTCGCCGCTCCTACT
CCGGCGCCGCGCCCCTATCGCCGGCGCTCTCCTCTTCCTCAGCCTCGGCGCCTTCGCAGG
GGTGAGAAGTCTCAGCTCTTCAGCTTCTGCTCGAATGGAGTCTACTTCCACCACTGTGCC
TTCCATTGTTGTGTATGTGACAGTTCCTAATAAAGAAGCAGGAAAGAGGCTAGCTGGGAG
CATTATAAGTGAGAAGCTTGCTGCTTGTGTGAACATAGTGCCTGGTATTGAATCTGTTTA
CTGGTGGGAAGGAAAGGTGCAAACTGATGCTGAAGAACTGCTCATCATAAAGACAAGGGA
GTCTCTTCTTGATGCGTTGACCGAACACGTGAAAGCCAACCATGAGTATGACGTTCCTGA
AGTCATCGCGCTGCCCATAAAAGGAGGCAACCTCAAGTACCTGGAGTGGCTAAAGAACAG
CACTAGGGAAAGCTAACTCTGTGCCGTGGCATGCTTTTTCACTACATTTCGAAGCGTCTG
GTGATACGTATACTCTGCATCTCCATGGCTTCGGTGTGAAGTGTGATGGATTTTCCTATC
TTTTACAGCTTATGTCAAATAAACTGTAGTAGCGTGCGTGCATGGCAGATGTTGTACATG
AAACCCTCTCGTGTTTGTGGAGTTAGACGACATTTCGTTTCTATTTGATTTTTTTTTGGG
T

CDS

534 bp

>Os10t0378300-01 CutA1 protein
ATGCCACTCCTCCCCTCCCCGCTCGGATCTCTCTCCGCCGCCGCCACCGCCGCCCCACGC
CGCGCCGCCGCGGCTGCCGGGCTCTCGCCGCTCCTACTCCGGCGCCGCGCCCCTATCGCC
GGCGCTCTCCTCTTCCTCAGCCTCGGCGCCTTCGCAGGGGTGAGAAGTCTCAGCTCTTCA
GCTTCTGCTCGAATGGAGTCTACTTCCACCACTGTGCCTTCCATTGTTGTGTATGTGACA
GTTCCTAATAAAGAAGCAGGAAAGAGGCTAGCTGGGAGCATTATAAGTGAGAAGCTTGCT
GCTTGTGTGAACATAGTGCCTGGTATTGAATCTGTTTACTGGTGGGAAGGAAAGGTGCAA
ACTGATGCTGAAGAACTGCTCATCATAAAGACAAGGGAGTCTCTTCTTGATGCGTTGACC
GAACACGTGAAAGCCAACCATGAGTATGACGTTCCTGAAGTCATCGCGCTGCCCATAAAA
GGAGGCAACCTCAAGTACCTGGAGTGGCTAAAGAACAGCACTAGGGAAAGCTAA

Protein

177 aa

>Os10t0378300-01 CutA1 protein
MPLLPSPLGSLSAAATAAPRRAAAAAGLSPLLLRRRAPIAGALLFLSLGAFAGVRSLSSS
ASARMESTSTTVPSIVVYVTVPNKEAGKRLAGSIISEKLAACVNIVPGIESVYWWEGKVQ
TDAEELLIIKTRESLLDALTEHVKANHEYDVPEVIALPIKGGNLKYLEWLKNSTRES*

5'UTR

chr10:12107783..12107804 (+ strand) : 22 bp

CDS

chr10:12107805..12107962 (+ strand) : 158 bp

chr10:12108282..12108382 (+ strand) : 101 bp

chr10:12109614..12109676 (+ strand) : 63 bp

chr10:12112139..12112170 (+ strand) : 32 bp

chr10:12112325..12112419 (+ strand) : 95 bp

chr10:12112538..12112622 (+ strand) : 85 bp

3'UTR

chr10:12112623..12112847 (+ strand) : 225 bp

FASTA

>Os10t0378300-01 class=Sequence position=chr10:12107783..12112847 (+ strand)
TGTAGGCCGA AGCTCCCAGA AGATGCCACT CCTCCCCTCC CCGCTCGGAT CTCTCTCCGC CGCCGCCACC GCCGCCCCAC
GCCGCGCCGC CGCGGCTGCC GGGCTCTCGC CGCTCCTACT CCGGCGCCGC GCCCCTATCG CCGGCGCTCT CCTCTTCCTC
AGCCTCGGCG CCTTCGCAGG GTAACGCGCC TCTCCAATCA ATCTAGGAGG ATTCCGCAGT TTGACCGGTG CTAACTATTG
TTCATAGGAT TCGATGGGAT TCAAAGATTT GGTCATATGA TTCGAAATGA ATGGGGACGG TTTGAGTTCT TGGTTGCTCA
CAGAAGTGAT GTATAGGAAC TATTGTGCCG ATTGTGCTTA AATGCGAAGT GCTTCACTCT TTTTACCTTG ATGGAGGATG
GGAGTGGTGT TATATTTACA GCCTAGTTAC ATCAAAGTAA TGTAGTCACT TTGGATTTGT TTTCTGGACT GGTAAATAAC
CAGTATGGGA ACTTTACAGG GTGAGAAGTC TCAGCTCTTC AGCTTCTGCT CGAATGGAGT CTACTTCCAC CACTGTGCCT
TCCATTGTTG TGTATGTGAC AGTTCCTAAT AAAGAAGCAG GTACATTGTT TATATGtgac actagacctg tacttttgtg
ataactttgt tactaaattt gtagttttgt gatagtccac cttaaatctg cagttctgtg agaaaattaa atctgtaatt
ttgtgataca tcatctcaaa tctatagttt tatgataatt tgGCTAAAAT Atacttcctc cgtttcacaa tgtaagtcat
tctagcattt cccacattca tagtgatgtt aatgaatcta gacatatata tctatctaga ttcattaaca tcaatatgaa
tgtgggaaat gctagaatga cttacattgt gaaatggagg aagtaTGTAG TTTTGTGAAA TTTACTCTGT GTTTTATTGT
CATTTAATTG TACCTGTtgt taacacccaa attcggcacc tagattcgaa ataggaaaac atcgccaaaa tttggaaatg
attggtttcc ttcacagagc cgatctgacc gctgcctatg ggtcggtctt accggtggtg tgtggccggt cagaccgatt
ccaagttgaa tttcaccaag tctcgggttt ccttgcttgg gtttccttgc ttggtgaggt atttttaaag ttctaattgg
tctctaccct gagtttgatg tggaggagat tgtaggaggc aagaccaacc cctttataag gaacaagacc aaggccggtt
caattgaaca cacaatctac tttgaacaca attagccaat tgaatcactt tttcaatatc atgtctactt ttttgcttag
ttctagccta gttttgttca tctttgtcga tttgcgcagt aaatcgccca ccttcgctgt gagagtgcga aatccctctg
taggttcggc ccgtaaaccc tgttcgccca caagacgggt gtttatcctt gtttcatcta aattggctcc gctagcctgt
ttaatcttgc aaaacccatc ttggtttagc tttgtctaga tcaaggtgtt tgacgactcc atatcaccgc aaggcattta
ggtgtctcga tcgtgcttgt cgacttgagc aaacaagttg tcaacacCTG TGCTGAACAA AGTAGAGATT ATTTCCTCAC
CCCATTGACT ATTTTAGTAG CTTCCATTCA AGAATAGCTT CTATTATGCT ACTCAGCGGT CCTAGCTGTA CTCATAACTA
TATTATTTTG ATAAGTTTGA TCTTTTTCTT TAGCAGCATT AGATGATTGC CTTTCTCATT TTTTTATACA GGAAAGAGGC
TAGCTGGGAG CATTATAAGT GAGAAGCTTG CTGCTTGTGT GAACATAGTG CCTGGTGAGA ACTACATCCT CTCTTCTTTT
TTTGTGTTTT TTTTTCTGTC CGCAGCTATC GATGCACTGA ACTATGCCTG GTGGGAACTA CGTCCTCTCT CTTTTTTCTC
TATCTGCATC TATAGATGCA CTGAACTAAG CGAACAAGCA AATTGGCTGG ACTTTATATA GTGGAGTTCA ATGCGAATCC
ATCATATTCA GTTCTGTTTC CATGGAAATT CTGCATATTG AACTTTGGTC AACTGAATGT TCAAAAACAA CTTTAACCAA
CTGGCTTCTC TATTTCTTGA GAAACGTAAT CAATGAAGTG CTCATATTTG TCTAGTAATC AGAATTTCTA ACAGTTGCCT
TGCCATGACT ATGGTAATGC GGGAAAAGGT GTTCACCTGT ATGACCATGT GGCATTTGAC AATTCTGAAA CATTGATGCA
GACATGTGCC TCTTCCTGTA AGCATCATTT GGCCATGTCG AGCTCCACAA CAACAGCACT GTTGGAATTA CACTTGATGA
AAGGGGCTCA ATTTAGAACA TCGCGGGATG AAACTCACAC TAATTAAtgt catgggcttt gggccgggag tcctaggccc
atgagataga attagggttt gttaggatta gataaggttt gttaggatta gattaagtag ccctccatct atataaggag
ggatcctatc ccaggtcagt taggcattag atcaatattt atcttagtgc ccatcggcct gccttctcag tgcgacggag
agcgtcgcgc cgtttaggtt caggaccgta ttccttgttc gtgacaactt ggtatcagag cttcggttct gtgcccatgg
gtgccgagat cactgcggtt cccaacatta gcgaaggtct tgccgagatc tcgaagaaga tgatgaactt ggcggcgcaa
ctccgggcct tggcggctca gtcaaccgag ccggctgctt tccttgagga ggccgaacca ttataccggc atgcggtggc
cttgcgtccg cgagggcgcg cggcgccaag tccgggagtg gctgcgcaac ctcgaccttg ccgctgggac tggcgatggc
gccgtcgcca ttggcgccct caatggtggt ggagaagaag acagcgacac aacacgactt gggtgtccgg ttctcgggca
cgatttccag gcgatgcgac gcggtttccg cagttggtgg cgcaaattct ggcaacggtt ggagcaaagc caggcggcgt
gcatgcggct cgagtcgcga gcgcgacggg tgggcgtggc actcgtgcgt cgcgatggcg tagattgcgc cgggtccaca
cgttggttcg tgaagctcgc ggctcgatca cggctgcatc gtttctggcg gcgtggcctc gtgaagaaca agaggatagg
gtttctgtcc tctcccaatt gggttggctg gtctggtctg ggtggtttcc acgttggccc atgaagcatc cgagtcaact
atttattcct ttgctgttgg gctggacaag tgggcttcgg tgggaggcat gctcagggtt tctgtaggac caggtcctcc
tgcgcatgaa ttgtttctta tttttgttca taataaaagc cgagatgtaa aaggcttaag agtcttagtt taggttatgg
tgttttgttt gagtctagca gggtccgctg caactcgagg acgagctgct caaaaagagg ggagtaatgt catgggcttt
gggccgggag tcctaggccc atgagataga attagggttt gttaggatta gataaggttt gttaggatta gattaagtag
ccctccatct atataaggag ggatcctatc ccaggtcagt taggcattag atcaatattt atcttagtgc ccatcggcct
gccttctcag tgcgacggag agcgtcgcgc cgtttaggtt caggaccgta ttccttgttc gtgacaATTA AGGGCTGAAA
AGAAATTGCT TTATGAATAT AAACGTGGTG GTAGGTCTAT TAGAAATGGA ACTAAGTGGT TTTTCTTGAT AACTACAACT
TGGCTTTTGA CAAGAAACGG AAAGTACATT CTCTAGCTTG TGGTAGCTGT CTAGCTGAAG CTCGACATAT TTGGTCTTTG
ATTGTCTTAT TGGTTGGACC CTCAATGCAA CATCAGACGT TTATTAAAAA ATACTGTAGC TGTTGGCAAT AGCTCTTCTT
TGTGCATAGG CACTGGAATG TGGTATGGAG TGGACACGAT GATGTGTTGT TACATGCATG CGGCAGCATG CTATTGTGTA
TCGCGCACTT TGCAATATAA TGGGACTTCA TCTAAAGAGA GACAAAATAA TGGAATTGCT AAGCTGAGAT ATCTATATTT
ATCCTCTCTA TTAGTTTTAT TCTGATTCAT GATTTTTTGG CCTACTTTCT ATCTTACATT ACATTAACAT CGACTCATTT
TATTTAGTTT TTAATTTTCT GTGTCCCTCT TTCCAGGTAT TGAATCTGTT TACTGGTGGG AAGGAAAGGT ACATTTCTAT
TCCTTCTTTG GGATAGGTTG ATTTCAAGCT TTAGCTGTTC ATTTAGCTTT GCACTCTCAC TATACTCCTT TAGGTCAATG
AGCGTTTTGC CTATTCCCTT ATGTAAAAAG ATATTTAGTG ATCAGCGGAT ATCTTTTTGC AGGTGCAAAC TGATGCTGAA
GAACTGCTCA TCATAAAGAC AAGGGAGTCT CTTCTTGATG CGTTGACCGA ACACGTGAAA GCCAACCATG AGTATGAGTA
AGTTCTTTTC TGTCCATCAA TTTTCATCTG TTTGTCAGTA TATACTGACA GGTCGTAAAC CTAAAATTTC TCTCTTGTCG
TGATCTGAGA TTCACTACTT GATTTCCCAA TGCAGCGTTC CTGAAGTCAT CGCGCTGCCC ATAAAAGGAG GCAACCTCAA
GTACCTGGAG TGGCTAAAGA ACAGCACTAG GGAAAGCTAA CTCTGTGCCG TGGCATGCTT TTTCACTACA TTTCGAAGCG
TCTGGTGATA CGTATACTCT GCATCTCCAT GGCTTCGGTG TGAAGTGTGA TGGATTTTCC TATCTTTTAC AGCTTATGTC
AAATAAACTG TAGTAGCGTG CGTGCATGGC AGATGTTGTA CATGAAACCC TCTCGTGTTT GTGGAGTTAG ACGACATTTC
GTTTCTATTT GATTTTTTTT TGGGT

Locus: Os10g0378300

Loading...

Locus: Os10g0378300

Loading...