Os10t0378300-02

Locus

Os10g0378300

Description

Similar to Protein CutA 1, chloroplastic.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CUTA1

CGSNL Gene Name

CU TOLERANCE A1

Oryzabase Gene Symbol Synonym(s)

OsCutA1

Oryzabase Gene Name Synonym(s)

"Protein CutA 1, chloroplastic"

Transcript Evidence

AK059907 (DDBJ, Best hit)

Protein Evidence

Q109R6 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: response to metal ion (GO:0010038)

Functional domain (InterPro)

Divalent ion tolerance protein, CutA (IPR004323)

Nitrogen regulatory PII-like, alpha/beta (IPR011322)

Full-length cDNA

006-208-H09 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0378300-02)

Others

Oryzabase (7181)

Transcript

916 bp

>Os10t0378300-02 Similar to Protein CutA 1, chloroplastic.
CTCCTCCCCTCCCCGCTCGGATCTCTCTCCGCCGCCGCCACCGCCGCCCCACGCCGCGCC
GCCGCGGCTGCCGGGCTCTCGCCGCTCCTACTCCGGCGCCGCGCCCCTATCGCCGGCGCT
CTCCTCTTCCTCAGCCTCGGCGCCTTCGCAGGGGTGAGAAGTCTCAGCTCTTCAGCTTCT
GCTCGAATGGAGTCTACTTCCACCACTGTGCCTTCCATTGTTGTGTATGTGACAGTTCCT
AATAAAGAAGCAGGAAAGAGGCTAGCTGGGAGCATTATAAGTGAGAAGCTTGCTGCTTGT
GTGAACATAGTGCCTGGTATTGAATCTGTTTACTGGTGGGAAGGAAAGGTGCAAACTGAT
GCTGAAGAACTGCTCATCATAAAGACAAGGGAGTCTCTTCTTGATGCGTTGACCGAACAC
GTGAAAGCCAACCATGAGTATGACGTTCCTGAAGTCATCGCGCTGCCCATAAAAGGAGGC
AACCTCAAGTACCTGGAGTGGCTAAAGAACAGCACTAGGGAAAGCTAACTCTGTGCCGTG
GCATGCTTTTTCACTACATTTCGAAGCGTCTGGTGATACGTATACTCTGCATCTCCATGG
CTTCGGTGTGAAGTGTGATGGATTTTCCTATCTTTTACAGCTTATGTCAAATAAACTGTA
GTAGCGTGCGTGCATGGCAGATGTTGTACATGAAACCCTCTCGTGTTTGTGGAGTTAGAC
GACATTTCGTTTCTATTTGATTTTTTTTTGGGTGAAGTCATGAATCTGTCATCTGTGTTA
TCACCTTTCCCATGTCAAACCCATCTTGAATGGTGGCTTGGCGTGAGGTTGGTTTCGCTG
TGAGTGCCCCAGTTAAAAGTGAATGCTTCTGGTCTGGTTGCACCGTAGCATATGCAATCA
GGTCTTGTCTTCCTAC

CDS

342 bp

>Os10t0378300-02 Similar to Protein CutA 1, chloroplastic.
ATGGAGTCTACTTCCACCACTGTGCCTTCCATTGTTGTGTATGTGACAGTTCCTAATAAA
GAAGCAGGAAAGAGGCTAGCTGGGAGCATTATAAGTGAGAAGCTTGCTGCTTGTGTGAAC
ATAGTGCCTGGTATTGAATCTGTTTACTGGTGGGAAGGAAAGGTGCAAACTGATGCTGAA
GAACTGCTCATCATAAAGACAAGGGAGTCTCTTCTTGATGCGTTGACCGAACACGTGAAA
GCCAACCATGAGTATGACGTTCCTGAAGTCATCGCGCTGCCCATAAAAGGAGGCAACCTC
AAGTACCTGGAGTGGCTAAAGAACAGCACTAGGGAAAGCTAA

Protein

113 aa

>Os10t0378300-02 Similar to Protein CutA 1, chloroplastic.
MESTSTTVPSIVVYVTVPNKEAGKRLAGSIISEKLAACVNIVPGIESVYWWEGKVQTDAE
ELLIIKTRESLLDALTEHVKANHEYDVPEVIALPIKGGNLKYLEWLKNSTRES*

5'UTR

chr10:12107811..12107962 (+ strand) : 152 bp

chr10:12108282..12108315 (+ strand) : 34 bp

CDS

chr10:12108316..12108382 (+ strand) : 67 bp

chr10:12109614..12109676 (+ strand) : 63 bp

chr10:12112139..12112170 (+ strand) : 32 bp

chr10:12112325..12112419 (+ strand) : 95 bp

chr10:12112538..12112622 (+ strand) : 85 bp

3'UTR

chr10:12112623..12113010 (+ strand) : 388 bp

FASTA

>Os10t0378300-02 class=Sequence position=chr10:12107811..12113010 (+ strand)
CTCCTCCCCT CCCCGCTCGG ATCTCTCTCC GCCGCCGCCA CCGCCGCCCC ACGCCGCGCC GCCGCGGCTG CCGGGCTCTC
GCCGCTCCTA CTCCGGCGCC GCGCCCCTAT CGCCGGCGCT CTCCTCTTCC TCAGCCTCGG CGCCTTCGCA GGGTAACGCG
CCTCTCCAAT CAATCTAGGA GGATTCCGCA GTTTGACCGG TGCTAACTAT TGTTCATAGG ATTCGATGGG ATTCAAAGAT
TTGGTCATAT GATTCGAAAT GAATGGGGAC GGTTTGAGTT CTTGGTTGCT CACAGAAGTG ATGTATAGGA ACTATTGTGC
CGATTGTGCT TAAATGCGAA GTGCTTCACT CTTTTTACCT TGATGGAGGA TGGGAGTGGT GTTATATTTA CAGCCTAGTT
ACATCAAAGT AATGTAGTCA CTTTGGATTT GTTTTCTGGA CTGGTAAATA ACCAGTATGG GAACTTTACA GGGTGAGAAG
TCTCAGCTCT TCAGCTTCTG CTCGAATGGA GTCTACTTCC ACCACTGTGC CTTCCATTGT TGTGTATGTG ACAGTTCCTA
ATAAAGAAGC AGGTACATTG TTTATATGtg acactagacc tgtacttttg tgataacttt gttactaaat ttgtagtttt
gtgatagtcc accttaaatc tgcagttctg tgagaaaatt aaatctgtaa ttttgtgata catcatctca aatctatagt
tttatgataa tttgGCTAAA ATAtacttcc tccgtttcac aatgtaagtc attctagcat ttcccacatt catagtgatg
ttaatgaatc tagacatata tatctatcta gattcattaa catcaatatg aatgtgggaa atgctagaat gacttacatt
gtgaaatgga ggaagtaTGT AGTTTTGTGA AATTTACTCT GTGTTTTATT GTCATTTAAT TGTACCTGTt gttaacaccc
aaattcggca cctagattcg aaataggaaa acatcgccaa aatttggaaa tgattggttt ccttcacaga gccgatctga
ccgctgccta tgggtcggtc ttaccggtgg tgtgtggccg gtcagaccga ttccaagttg aatttcacca agtctcgggt
ttccttgctt gggtttcctt gcttggtgag gtatttttaa agttctaatt ggtctctacc ctgagtttga tgtggaggag
attgtaggag gcaagaccaa cccctttata aggaacaaga ccaaggccgg ttcaattgaa cacacaatct actttgaaca
caattagcca attgaatcac tttttcaata tcatgtctac ttttttgctt agttctagcc tagttttgtt catctttgtc
gatttgcgca gtaaatcgcc caccttcgct gtgagagtgc gaaatccctc tgtaggttcg gcccgtaaac cctgttcgcc
cacaagacgg gtgtttatcc ttgtttcatc taaattggct ccgctagcct gtttaatctt gcaaaaccca tcttggttta
gctttgtcta gatcaaggtg tttgacgact ccatatcacc gcaaggcatt taggtgtctc gatcgtgctt gtcgacttga
gcaaacaagt tgtcaacacC TGTGCTGAAC AAAGTAGAGA TTATTTCCTC ACCCCATTGA CTATTTTAGT AGCTTCCATT
CAAGAATAGC TTCTATTATG CTACTCAGCG GTCCTAGCTG TACTCATAAC TATATTATTT TGATAAGTTT GATCTTTTTC
TTTAGCAGCA TTAGATGATT GCCTTTCTCA TTTTTTTATA CAGGAAAGAG GCTAGCTGGG AGCATTATAA GTGAGAAGCT
TGCTGCTTGT GTGAACATAG TGCCTGGTGA GAACTACATC CTCTCTTCTT TTTTTGTGTT TTTTTTTCTG TCCGCAGCTA
TCGATGCACT GAACTATGCC TGGTGGGAAC TACGTCCTCT CTCTTTTTTC TCTATCTGCA TCTATAGATG CACTGAACTA
AGCGAACAAG CAAATTGGCT GGACTTTATA TAGTGGAGTT CAATGCGAAT CCATCATATT CAGTTCTGTT TCCATGGAAA
TTCTGCATAT TGAACTTTGG TCAACTGAAT GTTCAAAAAC AACTTTAACC AACTGGCTTC TCTATTTCTT GAGAAACGTA
ATCAATGAAG TGCTCATATT TGTCTAGTAA TCAGAATTTC TAACAGTTGC CTTGCCATGA CTATGGTAAT GCGGGAAAAG
GTGTTCACCT GTATGACCAT GTGGCATTTG ACAATTCTGA AACATTGATG CAGACATGTG CCTCTTCCTG TAAGCATCAT
TTGGCCATGT CGAGCTCCAC AACAACAGCA CTGTTGGAAT TACACTTGAT GAAAGGGGCT CAATTTAGAA CATCGCGGGA
TGAAACTCAC ACTAATTAAt gtcatgggct ttgggccggg agtcctaggc ccatgagata gaattagggt ttgttaggat
tagataaggt ttgttaggat tagattaagt agccctccat ctatataagg agggatccta tcccaggtca gttaggcatt
agatcaatat ttatcttagt gcccatcggc ctgccttctc agtgcgacgg agagcgtcgc gccgtttagg ttcaggaccg
tattccttgt tcgtgacaac ttggtatcag agcttcggtt ctgtgcccat gggtgccgag atcactgcgg ttcccaacat
tagcgaaggt cttgccgaga tctcgaagaa gatgatgaac ttggcggcgc aactccgggc cttggcggct cagtcaaccg
agccggctgc tttccttgag gaggccgaac cattataccg gcatgcggtg gccttgcgtc cgcgagggcg cgcggcgcca
agtccgggag tggctgcgca acctcgacct tgccgctggg actggcgatg gcgccgtcgc cattggcgcc ctcaatggtg
gtggagaaga agacagcgac acaacacgac ttgggtgtcc ggttctcggg cacgatttcc aggcgatgcg acgcggtttc
cgcagttggt ggcgcaaatt ctggcaacgg ttggagcaaa gccaggcggc gtgcatgcgg ctcgagtcgc gagcgcgacg
ggtgggcgtg gcactcgtgc gtcgcgatgg cgtagattgc gccgggtcca cacgttggtt cgtgaagctc gcggctcgat
cacggctgca tcgtttctgg cggcgtggcc tcgtgaagaa caagaggata gggtttctgt cctctcccaa ttgggttggc
tggtctggtc tgggtggttt ccacgttggc ccatgaagca tccgagtcaa ctatttattc ctttgctgtt gggctggaca
agtgggcttc ggtgggaggc atgctcaggg tttctgtagg accaggtcct cctgcgcatg aattgtttct tatttttgtt
cataataaaa gccgagatgt aaaaggctta agagtcttag tttaggttat ggtgttttgt ttgagtctag cagggtccgc
tgcaactcga ggacgagctg ctcaaaaaga ggggagtaat gtcatgggct ttgggccggg agtcctaggc ccatgagata
gaattagggt ttgttaggat tagataaggt ttgttaggat tagattaagt agccctccat ctatataagg agggatccta
tcccaggtca gttaggcatt agatcaatat ttatcttagt gcccatcggc ctgccttctc agtgcgacgg agagcgtcgc
gccgtttagg ttcaggaccg tattccttgt tcgtgacaAT TAAGGGCTGA AAAGAAATTG CTTTATGAAT ATAAACGTGG
TGGTAGGTCT ATTAGAAATG GAACTAAGTG GTTTTTCTTG ATAACTACAA CTTGGCTTTT GACAAGAAAC GGAAAGTACA
TTCTCTAGCT TGTGGTAGCT GTCTAGCTGA AGCTCGACAT ATTTGGTCTT TGATTGTCTT ATTGGTTGGA CCCTCAATGC
AACATCAGAC GTTTATTAAA AAATACTGTA GCTGTTGGCA ATAGCTCTTC TTTGTGCATA GGCACTGGAA TGTGGTATGG
AGTGGACACG ATGATGTGTT GTTACATGCA TGCGGCAGCA TGCTATTGTG TATCGCGCAC TTTGCAATAT AATGGGACTT
CATCTAAAGA GAGACAAAAT AATGGAATTG CTAAGCTGAG ATATCTATAT TTATCCTCTC TATTAGTTTT ATTCTGATTC
ATGATTTTTT GGCCTACTTT CTATCTTACA TTACATTAAC ATCGACTCAT TTTATTTAGT TTTTAATTTT CTGTGTCCCT
CTTTCCAGGT ATTGAATCTG TTTACTGGTG GGAAGGAAAG GTACATTTCT ATTCCTTCTT TGGGATAGGT TGATTTCAAG
CTTTAGCTGT TCATTTAGCT TTGCACTCTC ACTATACTCC TTTAGGTCAA TGAGCGTTTT GCCTATTCCC TTATGTAAAA
AGATATTTAG TGATCAGCGG ATATCTTTTT GCAGGTGCAA ACTGATGCTG AAGAACTGCT CATCATAAAG ACAAGGGAGT
CTCTTCTTGA TGCGTTGACC GAACACGTGA AAGCCAACCA TGAGTATGAG TAAGTTCTTT TCTGTCCATC AATTTTCATC
TGTTTGTCAG TATATACTGA CAGGTCGTAA ACCTAAAATT TCTCTCTTGT CGTGATCTGA GATTCACTAC TTGATTTCCC
AATGCAGCGT TCCTGAAGTC ATCGCGCTGC CCATAAAAGG AGGCAACCTC AAGTACCTGG AGTGGCTAAA GAACAGCACT
AGGGAAAGCT AACTCTGTGC CGTGGCATGC TTTTTCACTA CATTTCGAAG CGTCTGGTGA TACGTATACT CTGCATCTCC
ATGGCTTCGG TGTGAAGTGT GATGGATTTT CCTATCTTTT ACAGCTTATG TCAAATAAAC TGTAGTAGCG TGCGTGCATG
GCAGATGTTG TACATGAAAC CCTCTCGTGT TTGTGGAGTT AGACGACATT TCGTTTCTAT TTGATTTTTT TTTGGGTGAA
GTCATGAATC TGTCATCTGT GTTATCACCT TTCCCATGTC AAACCCATCT TGAATGGTGG CTTGGCGTGA GGTTGGTTTC
GCTGTGAGTG CCCCAGTTAA AAGTGAATGC TTCTGGTCTG GTTGCACCGT AGCATATGCA ATCAGGTCTT GTCTTCCTAC

Locus: Os10g0378300

Loading...

Locus: Os10g0378300

Loading...