Os10t0390500-01

Locus

Os10g0390500

Description

Alanine aminotransferase, Starch synthesis in developing seeds

RAP-DB Gene Symbol Synonym(s)

ALAAT, alaAT, ALT-1, OsAlaAT1, AlaAT1

RAP-DB Gene Name Synonym(s)

ALANINE AMINOTRANSFERASE, alanine aminotransferase, Alanine transaminase 1, alanine-aminotransferase1

CGSNL Gene Symbol

ALAAT

CGSNL Gene Name

ALANINE AMINOTRANSFERASE

Oryzabase Gene Symbol Synonym(s)

alaAT, ALT-1, OsAlaAT1, AlaAT1

Oryzabase Gene Name Synonym(s)

alanine aminotransferase, Alanine transaminase 1, alanine-aminotransferase1

Transcript Evidence

EU267962 (Ilpumbyeo)

AB007405

Protein Evidence

Q338N8

Literature

PMID: 26475189

PMID: 10080717

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 5, 2015

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

Pyridoxal phosphate-dependent transferase (IPR015424)

Aminotransferase, class I/classII (IPR004839)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Expression Databases

TENOR (Os10t0390500-01)

Others

Oryzabase (6005)

Transcript

1801 bp

>Os10t0390500-01 Alanine aminotransferase, Starch synthesis in developing seeds
GAAACCCAACCCGTCAACGCTGCCGCTGAATCTCACTTTCTCTCTCTGTTCTTGGTGCTT
CCGCcgccatggctgctcccagcgtcgccgtcgacaacctcaaccccaagGTTTTGAATT
GTGAGTATGCAGTGCGTGGAGAGATTGTGATCCATGCTCAGCGCCTGCAGCAACAGCTAC
AGACTCAACCAGGGTCTCTTCCTTTTGATGAGATCCTATACTGCAACATTGGGAATCCCC
AGTCTCTTGGTCAGAAGCCAGTTACATTCTTCAGGGAGGTTATTGCTCTTTGTGATCATC
CATGCTTGTTGGAAAAGGAGGAAACCAAATCATTGTTCAGtgctgatgccatttctcgag
caacaacaattcttgcctcgattcctggaagagcaactggagcatacagccacagccagg
gcatcaaagggctgcgtgatgcaattgctgctggaattgcatcacgtgacggataccctg
caaatgcagacgacattttccttactgacggagcaagccctggagttcacatgatgatgc
agttactgataaggaacgagaaagatggcattctctgcccaattcctcaatatcctttgt
actcagcctccattgctcttcatggtggagctcttgtcccgtattatcttaatgaatcaa
caggctggggtttggagatctctgaccttaagaagcaactcgaagattctcggttgaaag
gcattgatgttagggctttggtagttatcaatccaggaaatccaactgggcaggttcttg
ctgaggaaaaccaacgggacatagtgaagttctgcaaaaatgagggacttgttcttctgg
ctgatgaggtgtaccaagagaacatctatgttgacaacaagaaatttaactctttcaaga
agatagcgagatccatgggatacaacgaggatgatctccctttagtatcatttcaatctg
tttctaagggatattatggtgaatgtggcaaaagaggaggctacatggagattactggct
tcagtgctccagttagagagcagatctacaaagtggcgtcagtgaacttatgttccaata
tcactggccagatccttgccagcctcgtcatgaatccaccaaaggctggagatgcatcat
atgcttcatacaaggcagagaaagatggaatcctccaatcattagctcgccgtgcaaagg
cattggagaatgctttcaacagtcttgagggaattacatgcaacaaaactgaaggagcaa
tgtacctcttccctcagcttagtctgccacaaaaggcaattgacgctgctaaagctgcta
acaaagcacctgatgctttctatgcccttcgtctcctcgaggcaaccggaattgttgttg
tccctggatctggatttggccaagttcctggcacatggcacatcagatgcacaatcctgc
cacaggaggagaagatccccgcgatcatctcccgcttcaaggcattccatgagggcttca
tggcagcgtaccgcgactgaattgccattcaccattgaacagatggggagttctatacaa
gcctgatggattttccccaggccttctttttttttgtccccATGATAGCATCATCGTGTA
GACCAAAACAAAATAAATCAAAGCCAGACATGCTTTTTTTTAGTGTGCTAATCACAGAGG
GTACTGAAAAACTGATGCCTTCGATGGCAAATTGAGGAGAAATTTACCTGCCATTTCGTT
GTTGTGCCTGTTACTGTATAAATGTTAAGATTTTGGTGCAGAGGCAGCTATAGTTTTGAG
A

CDS

1452 bp

>Os10t0390500-01 Alanine aminotransferase, Starch synthesis in developing seeds
atggctgctcccagcgtcgccgtcgacaacctcaaccccaagGTTTTGAATTGTGAGTAT
GCAGTGCGTGGAGAGATTGTGATCCATGCTCAGCGCCTGCAGCAACAGCTACAGACTCAA
CCAGGGTCTCTTCCTTTTGATGAGATCCTATACTGCAACATTGGGAATCCCCAGTCTCTT
GGTCAGAAGCCAGTTACATTCTTCAGGGAGGTTATTGCTCTTTGTGATCATCCATGCTTG
TTGGAAAAGGAGGAAACCAAATCATTGTTCAGtgctgatgccatttctcgagcaacaaca
attcttgcctcgattcctggaagagcaactggagcatacagccacagccagggcatcaaa
gggctgcgtgatgcaattgctgctggaattgcatcacgtgacggataccctgcaaatgca
gacgacattttccttactgacggagcaagccctggagttcacatgatgatgcagttactg
ataaggaacgagaaagatggcattctctgcccaattcctcaatatcctttgtactcagcc
tccattgctcttcatggtggagctcttgtcccgtattatcttaatgaatcaacaggctgg
ggtttggagatctctgaccttaagaagcaactcgaagattctcggttgaaaggcattgat
gttagggctttggtagttatcaatccaggaaatccaactgggcaggttcttgctgaggaa
aaccaacgggacatagtgaagttctgcaaaaatgagggacttgttcttctggctgatgag
gtgtaccaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatagcg
agatccatgggatacaacgaggatgatctccctttagtatcatttcaatctgtttctaag
ggatattatggtgaatgtggcaaaagaggaggctacatggagattactggcttcagtgct
ccagttagagagcagatctacaaagtggcgtcagtgaacttatgttccaatatcactggc
cagatccttgccagcctcgtcatgaatccaccaaaggctggagatgcatcatatgcttca
tacaaggcagagaaagatggaatcctccaatcattagctcgccgtgcaaaggcattggag
aatgctttcaacagtcttgagggaattacatgcaacaaaactgaaggagcaatgtacctc
ttccctcagcttagtctgccacaaaaggcaattgacgctgctaaagctgctaacaaagca
cctgatgctttctatgcccttcgtctcctcgaggcaaccggaattgttgttgtccctgga
tctggatttggccaagttcctggcacatggcacatcagatgcacaatcctgccacaggag
gagaagatccccgcgatcatctcccgcttcaaggcattccatgagggcttcatggcagcg
taccgcgactga

Protein

484 aa

>Os10t0390500-01 Alanine aminotransferase, Starch synthesis in developing seeds
MAAPSVAVDNLNPKVLNCEYAVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSL
GQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATTILASIPGRATGAYSHSQGIK
GLRDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSA
SIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEE
NQRDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSK
GYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYAS
YKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKA
PDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAA
YRD*

5'UTR

chr10:12968039..12968106 (+ strand) : 68 bp

CDS

chr10:12968107..12968148 (+ strand) : 42 bp

chr10:12969696..12969746 (+ strand) : 51 bp

chr10:12970351..12970401 (+ strand) : 51 bp

chr10:12970476..12970541 (+ strand) : 66 bp

chr10:12970608..12970669 (+ strand) : 62 bp

chr10:12971056..12971134 (+ strand) : 79 bp

chr10:12971215..12971319 (+ strand) : 105 bp

chr10:12971421..12971531 (+ strand) : 111 bp

chr10:12971614..12971751 (+ strand) : 138 bp

chr10:12971997..12972071 (+ strand) : 75 bp

chr10:12972171..12972291 (+ strand) : 121 bp

chr10:12972365..12972519 (+ strand) : 155 bp

chr10:12972601..12972675 (+ strand) : 75 bp

chr10:12972757..12972960 (+ strand) : 204 bp

chr10:12973702..12973818 (+ strand) : 117 bp

3'UTR

chr10:12973819..12974099 (+ strand) : 281 bp

FASTA

>Os10t0390500-01 class=Sequence position=chr10:12968039..12974099 (+ strand)
GAAACCCAAC CCGTCAACGC TGCCGCTGAA TCTCACTTTC TCTCTCTGTT CTTGGTGCTT CCGCcgccat ggctgctccc
agcgtcgccg tcgacaacct caaccccaag gtggtgatcc tgcgcctcct catgcccgtt tcttgatttt tcttttttTT
GTTCTTCTCT TCTCTTCTCT CTCTCTTTTT TTTTGTGGGG GTTGTAGAGG TTCTTGAGGA AAGATTGCAT TTTCGATGTG
ATGTGGTGTG AGGATAGGGA TTGGCTCGGT TTCGGACTTC CGGTGGAGTT TAGGGGTCAA AAGGAGGGAT TTTTTGGTCC
CTGTTCTTAG TTCGATTTCT TAGCGTAGCG AATTGAGCAT CCAATGGTCC TGATGTTGTC ATGGGAGTGA TTCAGAAGGG
GATATGGGTG GGGCAGTAGG GTGCTCTTGT TTTAGATAAT GGAAGAGTTT TGATAAGATG GTGTTCTAAT TTGATGGAGT
GGGTTGTGCT CTGGTTTTTT TTCTCCAGTG TAGTTATCAT GCTTAGTTCT TGTTCTTGTG TTCTGCTTGT CTAAATCTGT
GAATTCAAGG TGCCCAGTCC CCAGAAACGA GGAATTATCA CACATGCAGC GAGGAGGATC TTTCAATTAG CAGGGTAGTT
GCCATGAGCA ATTTTTAGTC TGCAAACAGT AATAGTTTTG TAGTTAATTA GAGATGCAGT TCTTTTACTT GGATGCTGTT
ACTTCTATTA ACACAGAGGT AGATCTCAGT ACTGGTTGAG CAGCTGCTGG CCTTCAGTTT TTGCCTTTTT GCCGTGATCG
AACAGTGCCA TGTAACATCA GCATCTCTTT TCCCTTTCAA AATGGAATAT GGCAATTTCA ATGAACTGTT GTCCCACTTC
TGCTACCAAA TAGTGACATG AAGATGCTGA AGCACCATAT TGTTGTTTCA GTGAGAGCAG AGGGTGCTGC TCACTTGCTC
CGATGGCAAC TTGTGTCTTG TGAAGATTCA GTTGGATTTT AAGGAGATAA TTATGCATTA GAATATTTAA TAGCAACTGC
TTTTAACAAG TTCTTTTTCC CTGTAGGCTT ATAAACCTGG AAAAAATATT ATATTTTGGG TGTTGTGTTA AACAATGGGG
AATAAATATC TGTTACCTTC CTCATGATGT CATTTTCATG CTATATTGGT TCCTACTATT ATTGAAAATT GATTATGATG
CTTTGCCTAT TTGGCAAGCT GGATAATATT GTGTTATTCT AACACTTTCA AAAGTACTGC CCGTGTGGTC TGCTTTTCAT
TTTCAACTTG CGCCATTCAA TAATTAATTA GCATTTAGCT CTATCAGCTG CACTGAAGCA AAACAGTAAT ATAGTATAGT
ATCATGGCCA CTTTATCTAT GTGTATATAT TATATTCTTC CCTGCAGGAA TTATTATTAT TACAGTTACA GTCACATGAT
TGCTTAACTA AATTGAATGT CATCCACTAT CCTGCCATAT AGTCCTAAAA ATTGATGCCC TTGACAAGTT CATAACAGTT
TTAGTTTGAG AATGCAATTG CAATTTCCTT CCTGAAGATT ACTTGTTCTA TTTACTGGAT TTCTAGTTAT TTTCTCTCCA
TCTCTTGATC AACCAGGTGC CTATTCTAGT GCCTAACTAA TAAGCTTACC CGTGCAGGTT TTGAATTGTG AGTATGCAGT
GCGTGGAGAG ATTGTGATCC ATGCTCAGGT ATCTTGAGTG ACGTCGGTGT GTTACTTTAT AATGGTTGTA ACCCGTGCAG
TTTTGATCTT TTTTTTCATT TGTATTCTTC TTGAATGAAA AGTTAACCAG CTAGTCCTAT GAACCTTTTA AATTAAAGGG
ATTTTTGTTT TCTTGTTCAT TAACTTTTAG GTACTTTGGC AATAGAATAG GGATTGAATA GTTGACAGTT GAATATAGCT
GTTAGAGCGT TCGGTGACAA TTCAATTAGT TTGCTGAACT TGATTATAGA AATGTTATTT TTATCGCACA ATCTTGCTTG
TTTTTTTGGA AGTGTTGAAT CCATATGGTT TTGTTGGAAC CTACCACCAA TTAGTGTCAA TTAATTACTT AACTGCCTAG
CTCGCAGAGA ATAAAGTAGT CATTGCTGAG ATATATAAAG GGAGAATAGT CAGTTAAGTT TCACCGTATC TAACGAAAAG
GTTTATCTTG TTGTCTGTGT TTGTCTAACA GTATAAACTT CTTATTCACA TCTCCTTGAC TTCCCCTGCA GTAGTAAACT
GTGCTGTTGT TTTTACAATA ATTCAATTAC CTGCTTATAA TTTGATATCT ATCTGTTTTC TTCTGTTTCC AGCGCCTGCA
GCAACAGCTA CAGACTCAAC CAGGGTCTCT TCCTTTTGAT GAGGTTAGTA ACTATCAATT TAACATAAAG GAGCTTTTCC
TGGTAGATTA TTTTCTCATT CTGTTTTCCC CTTGCAGATC CTATACTGCA ACATTGGGAA TCCCCAGTCT CTTGGTCAGA
AGCCAGTTAC ATTCTTCAGG GAGGTATGTG GTTATCTTGC CTTCAAGTTT TACATTTTGT TTCCATGATA TTCACATGCT
GTATTGCAGG TTATTGCTCT TTGTGATCAT CCATGCTTGT TGGAAAAGGA GGAAACCAAA TCATTGTTCA GGTGAATATC
GGCACCTTTA TTTCATCAGC ATCAAACAGA TATGCAGAGA ACTTAAATGG AGATATCTAG TGCAAACACT CACATTCCTT
TAGTTTGCTT ACCATATACT TCATCCTTTT GTTTCTCTCT ACTGATTGAG TTTTGACTAG AAATATTACA TGTTAGTTGA
GCATAGGAGT TTCAAAAACC AAAATCTTAT TGAGAAATTT TCAAGGTGGT TTATCCCTAG TTAAAAGGGC TAGGACTAAA
TCGATTAACT ATGCAACTGG CATATCACCC TAACTTAATT TCTAAAAGAG TTCTGCTCAT GAACTTCCAT AAATAGTTGA
CTATCATACT GAAATTTGAA ATTCTAGtga gtatctgatg ccccatcttt gctgcagtgc tgatgccatt tctcgagcaa
caacaattct tgcctcgatt cctggaagag caactggagc atacagccac agccaggtga gcagctcagg ctgatacatt
tactcactac aaagaaaaaa aaagaatctt aatttcaccg tactcatttt tcctagggca tcaaagggct gcgtgatgca
attgctgctg gaattgcatc acgtgacgga taccctgcaa atgcagacga cattttcctt actgacggag caagccctgg
agtaggaact ttaccttctt tttaaatctt actggacatt ttttgaataa acaggaagca gttcgaatct cattatgatg
ctattctccc cctctgtttt aggttcacat gatgatgcag ttactgataa ggaacgagaa agatggcatt ctctgcccaa
ttcctcaata tcctttgtac tcagcctcca ttgctcttca tggtggagct cttgtatgtt ttgaattctc agcacatttt
caatatggct gcattcatgc tgcaccaaag cctaattgag agcattttgt tttaggtccc gtattatctt aatgaatcaa
caggctgggg tttggagatc tctgacctta agaagcaact cgaagattct cggttgaaag gcattgatgt tagggctttg
gtagttatca atccaggaaa tccaactggg caggtttgca ttcattgctt tcttgtctaa tttggagagc atcttggatt
gttgcaattt ctgttcacac catattctgc atgtatctac ctaaggcata tatatttgca attcttgtat ctttttatgt
gattttccat tgttagggaa catatgtatt tttgtttgtc tgcaatgtgc atgaagcatt tgcagctggt gcaggtaccc
aacaaaagaa ctgtaatcat gttttaattc atttgcaggt tcttgctgag gaaaaccaac gggacatagt gaagttctgc
aaaaatgagg gacttgttct tctggctgat gaggtaagcg attgttactt gagcaactcc acaacaaact ttcagctgct
taattccttt tcgctgtgct gtctgtaaca tcaacactat tcatattgat aggtgtacca agagaacatc tatgttgaca
acaagaaatt taactctttc aagaagatag cgagatccat gggatacaac gaggatgatc tccctttagt atcatttcaa
tctgtttcta agggtaaata cgatgatctg ttttcttatt ttctattggc actggattct caaaaggatt ttcttgctga
caacaggata ttatggtgaa tgtggcaaaa gaggaggcta catggagatt actggcttca gtgctccagt tagagagcag
atctacaaag tggcgtcagt gaacttatgt tccaatatca ctggccagat ccttgccagc ctcgtcatga atccaccaaa
ggtcaatgtt ctgtcattgt ttaaatttct acctaagaaa gtgcaaaagt ctctaatcag ataccattat ttgattctgc
aggctggaga tgcatcatat gcttcataca aggcagagaa agatggaatc ctccaatcat tagctcgccg tgcaaaggta
taccaggatt ccaattctct tatactgcta aatgatatct gggaacaaat tgtagaattg tttttttctt gatggcaggc
attggagaat gctttcaaca gtcttgaggg aattacatgc aacaaaactg aaggagcaat gtacctcttc cctcagctta
gtctgccaca aaaggcaatt gacgctgcta aagctgctaa caaagcacct gatgctttct atgcccttcg tctcctcgag
gcaaccggaa ttgttgttgt ccctggatct ggatttggcc aagtgagtca acttaatctt tatacgaaga atataatatg
cttgtgcttg tatctgctga tactactggt ttggacatat TAAGTCAAAA CAAATTTTCC TTAAAAGATT CAACGTCACT
TTTTATGCCA CCAAATAACA ATCATGGTTT TTTTTCTCAT AAGTTCCTGA ATATATCTTT GTGTTGAGCT TCTGCAACAA
ATATCTGAAA ATAATCATCC CTGAATAGAA CTTCTCATAC TATTGCGTTC TTACCATGCT ATTTGGTCAC TAGATATTTT
Gtactccctc cgtccctaaa tatttgacgc cgttgacttt ttaaaacata tttgaccgtt cgtcttattc aaaaaaatta
agtaattatt aattcctttc ctatcatttg attcattgtt aaatatactt ttatgtatac atatagtttt acatatttca
caaaagtttt tgaataagac gaacggtcaa acatgtttaa aaaagtcaac ggcgtcaaat atttagggaa ggagggagta
CTAAAAATTT ATTACTGGCA TATGGTGATG TTATCAACTA AAAAGATTCC TGGGACACAT CATGTATCTG CCTCTTTTGT
TCTGTTTCAA CAACTATCTT GTTATAATTC TGTGTGTCCA AACCTGAAAG CTACTTTGAA GTTTACGAAC AATAAGCACT
CCATGCACTT TATTTTTTGG CATATCCATG GTACTGATTT TGTTTTCctc ttctactcca aaggttcctg gcacatggca
catcagatgc acaatcctgc cacaggagga gaagatcccc gcgatcatct cccgcttcaa ggcattccat gagggcttca
tggcagcgta ccgcgactga attgccattc accattgaac agatggggag ttctatacaa gcctgatgga ttttccccag
gccttctttt tttttgtccc cATGATAGCA TCATCGTGTA GACCAAAACA AAATAAATCA AAGCCAGACA TGCTTTTTTT
TAGTGTGCTA ATCACAGAGG GTACTGAAAA ACTGATGCCT TCGATGGCAA ATTGAGGAGA AATTTACCTG CCATTTCGTT
GTTGTGCCTG TTACTGTATA AATGTTAAGA TTTTGGTGCA GAGGCAGCTA TAGTTTTGAG A

Locus: Os10g0390500

Loading...

Locus: Os10g0390500

Loading...