Os10t0391400-01

Locus

Os10g0391400

Description

Jasmonate ZIM-domain (JAZ) protein, TIFY family protein, Negative regulation of JA signal transduction pathway, Activation of hypersensitive cell death

RAP-DB Gene Symbol Synonym(s)

OsJAZ13, OsTIFY11e, OsJAZ13a

RAP-DB Gene Name Synonym(s)

Jasmonate ZIM-domain protein 13

CGSNL Gene Symbol

TIFY11E

CGSNL Gene Name

TIFY GENE 11E

Oryzabase Gene Symbol Synonym(s)

OsJAZ 13, OsJAZ13, JAZ13, OsTIFY11e, OsJAZ13a, OsJAZ13b, OsJAZ13c, OsJAZ13d

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 13

Transcript Evidence

AK107854

Protein Evidence

Q7XEZ6

Literature

PMID: 32575555

Note

Manual Curation

June 25, 2020

Functional domain (InterPro)

Tify domain (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-134-A12 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0391400-01)

RiceXPro (AK107854)

Others

Oryzabase (15069)

KEGG (Os10t0391400-01)

Transcript

827 bp

>Os10t0391400-01 Jasmonate ZIM-domain (JAZ) protein, TIFY family protein, Negative regulation of JA signal transduction pathway, Activation of hypersensitive cell death
AAGAAGAAATTAACCCGAGATTTTCTCCGAACACCTCGACGACCCCATCGAGAGCAAGCA
GCGGCTGGTTGATTTTGATCGATCGATCGATCGATCACCGGTGATGGCGGCGGAGGCGGC
GGCGACGAGCAGGTTCGCGGCGGCGTGCGGCGCGCTGAGCCAGTACGTGAGGGCGGCGGA
TAACGTCCACAGGGCGCGGACGGCGGCGGCGGCGGCGGCGGTGCGGCCACTCCCGCTCAT
GCCGGGGGCCGACGTCGCCGGAGACGAGCGGGAGGAGGAAGGAGGCGGCGCCGCGGCATC
GTCGGCGGCGGCGCAGATGACCATCTTCTACGGCGGGCGGGTGCTGGTGCTCGACGAGTG
CCCCGCGGACAGGGCGGCGGCGCTGCTGCGGCTCGCCGCCTCGTCCAGGGGCGTGCCCCG
CGACGATCTCGCCAGCACTGCCGCCGCCGCCGGCGAGTCGGCGGACCTGCCGGTGGCGAG
GAAGGCGTCGCTGCAGCGGTTCATGGAGAAGAGGAAGGGCAGGCTCGCCGCCCGCGGCCA
GCCGTACCGGCGCCACGACGCCGCGGCGGCGGCGCGCGGCGACCACCTCGCGCTCGCGCT
CTGATCAGTACACGTCAGCTTTAATCCCATAATTAACGAGGCCGTGAGGATGCTTATGCT
TGCAGCATTTGTACAGTGCACGATTATTCCTATCTGTCACAAGTAGTAGTAGTAGTTTTA
GTAGTAGTACATATGCTAGGGATCATATAATTTCATTGGAAAGAGTTGAAATGTACAGAA
AAAAAAATACTGAAAGAACGATGATGGAATTCAAACATCTCTATGTT

CDS

501 bp

>Os10t0391400-01 Jasmonate ZIM-domain (JAZ) protein, TIFY family protein, Negative regulation of JA signal transduction pathway, Activation of hypersensitive cell death
ATGGCGGCGGAGGCGGCGGCGACGAGCAGGTTCGCGGCGGCGTGCGGCGCGCTGAGCCAG
TACGTGAGGGCGGCGGATAACGTCCACAGGGCGCGGACGGCGGCGGCGGCGGCGGCGGTG
CGGCCACTCCCGCTCATGCCGGGGGCCGACGTCGCCGGAGACGAGCGGGAGGAGGAAGGA
GGCGGCGCCGCGGCATCGTCGGCGGCGGCGCAGATGACCATCTTCTACGGCGGGCGGGTG
CTGGTGCTCGACGAGTGCCCCGCGGACAGGGCGGCGGCGCTGCTGCGGCTCGCCGCCTCG
TCCAGGGGCGTGCCCCGCGACGATCTCGCCAGCACTGCCGCCGCCGCCGGCGAGTCGGCG
GACCTGCCGGTGGCGAGGAAGGCGTCGCTGCAGCGGTTCATGGAGAAGAGGAAGGGCAGG
CTCGCCGCCCGCGGCCAGCCGTACCGGCGCCACGACGCCGCGGCGGCGGCGCGCGGCGAC
CACCTCGCGCTCGCGCTCTGA

Protein

167 aa

>Os10t0391400-01 Jasmonate ZIM-domain (JAZ) protein, TIFY family protein, Negative regulation of JA signal transduction pathway, Activation of hypersensitive cell death
MAAEAAATSRFAAACGALSQYVRAADNVHRARTAAAAAAVRPLPLMPGADVAGDEREEEG
GGAAASSAAAQMTIFYGGRVLVLDECPADRAAALLRLAASSRGVPRDDLASTAAAAGESA
DLPVARKASLQRFMEKRKGRLAARGQPYRRHDAAAAARGDHLALAL*

5'UTR

chr10:13031904..13032006 (- strand) : 103 bp

CDS

chr10:13031403..13031903 (- strand) : 501 bp

3'UTR

chr10:13031180..13031402 (- strand) : 223 bp

FASTA

>Os10t0391400-01 class=Sequence position=chr10:13031180..13032006 (- strand)
AAGAAGAAAT TAACCCGAGA TTTTCTCCGA ACACCTCGAC GACCCCATCG AGAGCAAGCA GCGGCTGGTT GATTTTGATC
GATCGATCGA TCGATCACCG GTGATGGCGG CGGAGGCGGC GGCGACGAGC AGGTTCGCGG CGGCGTGCGG CGCGCTGAGC
CAGTACGTGA GGGCGGCGGA TAACGTCCAC AGGGCGCGGA CGGCGGCGGC GGCGGCGGCG GTGCGGCCAC TCCCGCTCAT
GCCGGGGGCC GACGTCGCCG GAGACGAGCG GGAGGAGGAA GGAGGCGGCG CCGCGGCATC GTCGGCGGCG GCGCAGATGA
CCATCTTCTA CGGCGGGCGG GTGCTGGTGC TCGACGAGTG CCCCGCGGAC AGGGCGGCGG CGCTGCTGCG GCTCGCCGCC
TCGTCCAGGG GCGTGCCCCG CGACGATCTC GCCAGCACTG CCGCCGCCGC CGGCGAGTCG GCGGACCTGC CGGTGGCGAG
GAAGGCGTCG CTGCAGCGGT TCATGGAGAA GAGGAAGGGC AGGCTCGCCG CCCGCGGCCA GCCGTACCGG CGCCACGACG
CCGCGGCGGC GGCGCGCGGC GACCACCTCG CGCTCGCGCT CTGATCAGTA CACGTCAGCT TTAATCCCAT AATTAACGAG
GCCGTGAGGA TGCTTATGCT TGCAGCATTT GTACAGTGCA CGATTATTCC TATCTGTCAC AAGTAGTAGT AGTAGTTTTA
GTAGTAGTAC ATATGCTAGG GATCATATAA TTTCATTGGA AAGAGTTGAA ATGTACAGAA AAAAAAATAC TGAAAGAACG
ATGATGGAAT TCAAACATCT CTATGTT

Locus: Os10g0391400

Loading...

Locus: Os10g0391400

Loading...