Os10t0391801-01

Locus

Os10g0391801

Description

A member of the JASMONATE ZIM-domain (JAZ) family

RAP-DB Gene Symbol Synonym(s)

OsJAZ14, OsTIFY11f

RAP-DB Gene Name Synonym(s)

Jasmonate ZIM-domain protein 14

CGSNL Gene Symbol

TIFY11F

CGSNL Gene Name

TIFY GENE 11F

Oryzabase Gene Symbol Synonym(s)

OsJAZ 14, OsJAZ14, JAZ14, OsTIFY11f

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 14

Transcript Evidence

Inferred from literature

Protein Evidence

Q7XEZ4

Literature

PMID: 19618278

Note

Manual Curation

June 30, 2020

Functional domain (InterPro)

Tify domain (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Expression Databases

TENOR (Os10t0391801-00)

TENOR (Os10t0392101-00)

Others

Oryzabase (15070)

Transcript

993 bp

>Os10t0391801-01 A member of the JASMONATE ZIM-domain (JAZ) family
ATGGCAGTGTCGGATCATCATTGCGGCGGCGGCGGCCGGAGCTGGCGGTTCGCGGTGGCG
TGCGGCGTGCTCAGCCGGTGCGTCAAGGCCGAGGCGGCGGCGGCGGCGAACGGTCGCCAC
CGCCACCACCCCACGATGCTCCTCATGCCGGGAGCCGACGTCGAGCCGGACGTGAGGGAG
GAGGCGGCGGCGGCGGCGCAGCTGAAGATCATGTACGGCGGGCGGATGCTGGTGTTCGAC
GACTTCTTCCCCGCGGGGGGCGCGGTCGTCGAGCTGGTGCGCGCCGCGGCGCGCGCCGGG
CAGGACGTACGACGCGCGGGCGCGGCACGGCGGCGAGTCGGCGACAGCCGTGGGCTCGAC
GCTGGCCTGCCGGTGGTGAGGAAGGTGTCGCTACAGCGATTCGTGGAGAAGAGGCGTCGC
ATGCGGGTATACCatattttgtacactgacaagagtAGTCATCATGTACCGGGGCCGGGT
AGATATCGATCATGGCAGTGTCGGATCATCATTGCGGCGGTGGCCGGAGCTGGCGGTTTC
GTGGTGGCGTGCGGCGTGCTCAGCCGGTGCGTCAAGGCCGAGGCGGCGGCGGCGGCGGCG
AACGGTCGCCGCCACCACCACCACCACCACACCACGATGCTCCTCATGCCGGGAGCCGAC
GTCGAGCCGGACGTGAGGGAggaggcggctgcggcggcgcagctgaagatcatgtacggc
gggcggatgctggtgttcgacgacttcttccccgcggggggcgcggtcgtcgagctggtg
cgcgccgcggcgcgcgctgggcgggacgacgacggcgcgcgggcgcgacgccggcctgcc
ggtggtgaggaaggtgtcgctgcagcggtccgtggagAAGAGAAGTCGCAGGCGGCTCGG
GGCGACGGCGCCGTACATACTCGCCATTCGCCGCCAATGCTGCCGGCAAGGACGCCGGGA
TCAGGCCGCACTGACGACGCCGCGTTCTACTGA

CDS

993 bp

>Os10t0391801-01 A member of the JASMONATE ZIM-domain (JAZ) family
ATGGCAGTGTCGGATCATCATTGCGGCGGCGGCGGCCGGAGCTGGCGGTTCGCGGTGGCG
TGCGGCGTGCTCAGCCGGTGCGTCAAGGCCGAGGCGGCGGCGGCGGCGAACGGTCGCCAC
CGCCACCACCCCACGATGCTCCTCATGCCGGGAGCCGACGTCGAGCCGGACGTGAGGGAG
GAGGCGGCGGCGGCGGCGCAGCTGAAGATCATGTACGGCGGGCGGATGCTGGTGTTCGAC
GACTTCTTCCCCGCGGGGGGCGCGGTCGTCGAGCTGGTGCGCGCCGCGGCGCGCGCCGGG
CAGGACGTACGACGCGCGGGCGCGGCACGGCGGCGAGTCGGCGACAGCCGTGGGCTCGAC
GCTGGCCTGCCGGTGGTGAGGAAGGTGTCGCTACAGCGATTCGTGGAGAAGAGGCGTCGC
ATGCGGGTATACCatattttgtacactgacaagagtAGTCATCATGTACCGGGGCCGGGT
AGATATCGATCATGGCAGTGTCGGATCATCATTGCGGCGGTGGCCGGAGCTGGCGGTTTC
GTGGTGGCGTGCGGCGTGCTCAGCCGGTGCGTCAAGGCCGAGGCGGCGGCGGCGGCGGCG
AACGGTCGCCGCCACCACCACCACCACCACACCACGATGCTCCTCATGCCGGGAGCCGAC
GTCGAGCCGGACGTGAGGGAggaggcggctgcggcggcgcagctgaagatcatgtacggc
gggcggatgctggtgttcgacgacttcttccccgcggggggcgcggtcgtcgagctggtg
cgcgccgcggcgcgcgctgggcgggacgacgacggcgcgcgggcgcgacgccggcctgcc
ggtggtgaggaaggtgtcgctgcagcggtccgtggagAAGAGAAGTCGCAGGCGGCTCGG
GGCGACGGCGCCGTACATACTCGCCATTCGCCGCCAATGCTGCCGGCAAGGACGCCGGGA
TCAGGCCGCACTGACGACGCCGCGTTCTACTGA

Protein

331 aa

>Os10t0391801-01 A member of the JASMONATE ZIM-domain (JAZ) family
MAVSDHHCGGGGRSWRFAVACGVLSRCVKAEAAAAANGRHRHHPTMLLMPGADVEPDVRE
EAAAAAQLKIMYGGRMLVFDDFFPAGGAVVELVRAAARAGQDVRRAGAARRRVGDSRGLD
AGLPVVRKVSLQRFVEKRRRMRVYHILYTDKSSHHVPGPGRYRSWQCRIIIAAVAGAGGF
VVACGVLSRCVKAEAAAAAANGRRHHHHHHTTMLLMPGADVEPDVREEAAAAAQLKIMYG
GRMLVFDDFFPAGGAVVELVRAAARAGRDDDGARARRRPAGGEEGVAAAVRGEEKSQAAR
GDGAVHTRHSPPMLPARTPGSGRTDDAAFY*

CDS

chr10:13046553..13046977 (- strand) : 425 bp

chr10:13044979..13045009 (- strand) : 31 bp

chr10:13042901..13043437 (- strand) : 537 bp

FASTA

>Os10t0391801-01 class=Sequence position=chr10:13042901..13046977 (- strand)
ATGGCAGTGT CGGATCATCA TTGCGGCGGC GGCGGCCGGA GCTGGCGGTT CGCGGTGGCG TGCGGCGTGC TCAGCCGGTG
CGTCAAGGCC GAGGCGGCGG CGGCGGCGAA CGGTCGCCAC CGCCACCACC CCACGATGCT CCTCATGCCG GGAGCCGACG
TCGAGCCGGA CGTGAGGGAG GAGGCGGCGG CGGCGGCGCA GCTGAAGATC ATGTACGGCG GGCGGATGCT GGTGTTCGAC
GACTTCTTCC CCGCGGGGGG CGCGGTCGTC GAGCTGGTGC GCGCCGCGGC GCGCGCCGGG CAGGACGTAC GACGCGCGGG
CGCGGCACGG CGGCGAGTCG GCGACAGCCG TGGGCTCGAC GCTGGCCTGC CGGTGGTGAG GAAGGTGTCG CTACAGCGAT
TCGTGGAGAA GAGGCGTCGC ATGCGGTTCG GGGCGACGGC GCCGAACCTA CTCGCCATTC GCCGCCAATG CTGCCGGCAA
GGACGCCGGG ATCAGGCCGC ACTGACGACG CCGCGTTCCA CTGAATTCGA GCTCCCTTCC TTTTCTTTCG TGTGACCAAG
ATTCGTTTGG CTTTTGATTC GAATCGTACG ATTCAAGGCC AATTTACTGG CTTGTCTAGA AGTATATATG GCTTAGATTG
CAATAATTTA GGATTGAGAT TGGTGAAATC GTCTTGTTAT GTTGTCTTGG AATAATACTT TTGTTTTTTT TTACCTTGGG
AAGAATAGTT TTGTTGGCAT TTCAAATTAC CAACGAGGAG TAAAACTAAA CCATGCAATT TTCTACGCAA AATTTGATAC
AGACCATAGA ATTAAATCGT CGGAGTTGAT ACAGCGCTCT AGTTCTTCCC ACAAGGGTGA AAAAGCCTGA AGAGGGGCCA
TCTCCATTGG ACCTTCGTCC Atagggatta aaacggtagg aaaaatgctt aaaccatttc tgttaccatt tttttttctc
ggaaatgata ttggaacgca agagttagaa acgatgacaa tatcgatcca accggaacat cagaaaataT TGATTTAGAG
TTACTTGTCC TTCGCCCCTT TCACGGGGTT ATATATTTAT ACTCATAGGT CCATTTTCAT AAGGGACTCA TGGAGATAAT
CTTAGAAATC TTCGGTATAG TACTGGGGCA AGTCTGAATA GAACTCTATG GCCTTTGTAT Ttgtcgacgt ttgagatcgt
gactacggta tttggatggt atggggatcg ttggtactag ggtatatgcg agattgaggt aaaagagatg gagacaagga
tttttataca ggttcgtgcc ccttatctga caggtaatag ccttacatcc tgttggccaa aaccggtgtt gctctttatt
catctggatc acacaagtat aatatttggg ataacctatc taactgtcat caacttggcg gcatggataa ccagctcgta
gtcgacgaca tggtagtctt cctcctcgaa tataaacctg tcgagatcag agatggcgct agatctctct tactgatctc
cgtagacacc agatggggta tgtctagact aatctctaat gtcgatattt ggccacgtat tggtttgtgt gtatgttgtg
tcttgtggct tgtcccctct ccttctaggg ggcttgtatt tatacccata gatgtcccct tgtccaagta gaactaggga
gaccaatatg gatacaatcc gagtaatcat tgtcgttttc atatagaact ctattagtac ttccttatcc ggaacttctt
ctatatacga ggtttgttcc gtataagact tggtatatga tgggtcctac cgagcttagt cgattactat tgggtatgtg
gtatccataa ccctgacaGT ATTCTTTATT TATTTGGGAT GCTATATCTA TAATTTGGTG TGGGAGGGGG TCCATTCTAT
GGAAATGAGG TATTCTATAC ATGAATTATA TTTTTCTGTT GTTGCTAGGG TATACCatat tttgtacact gacaagagtg
taagtttcta aatttacaat gtaaatggat tgcaaatgta ggtaaataat ttatatagtg taaaaacgat ttaatgattt
ttaatggaaa atatagtgcc ataaatataa ctattcccAA AGAAAAATAC GGAGAACATA TATATTTCAT TTGAACTAGC
TTTCATATTA GCTTTTCAAG TCCTACACTG TCCTAAAATA TAGTGTGGTC ATGTGCTCTC CATGCATGGC TACGATTGGC
ACGAGCTTGT GTGTGCTTCT TCTTCTACCA GTCATTTATG GTTGTCCAGC CATGCTAACT CCACCAGGCA CGATGTTCAC
AAGAACAATA TGTAGGCACA ATGTTCACAA GAATAGTAGG AGAGGAGACC ATCACTCAGT TAAAACACGA GTTGTTTGCA
CCAATTGTGT TGTTAGCCGT TTCATTGCAT TTGCATGTGT TGTTAGCCGT TTCATTGCAT TTTGCATGCA AGTCGCCCAC
GCACGGCCTG CACGTTATTC TTCTTTCCAT CACTTGATCA ATACACTACT CCTTTGTGAC TGTGAACACC AACAGAAACG
TTCCAACCAT GCATTTAAAT TGTGTCCATA ACATAAACAT GGTTTAATAA TTTTGTTTAG AAAAGCCTGG TCTAGTGATT
AATTATGTTA TTTGTTTTGT TAATTTATTG TCTTGTGTAG TGTCATGTAA CACGATGGGA GTAAATTACT TATTCATGGA
AGTTGAAGCA AATTGTAAAA CATATGACTA CTTGAAGCAA ATTGTATTAA CTTGGGTGTT AACTGTGTTG CGTATTCTCC
AAAACCTACT GTTTATTCAC TTTTTTTAAA AAAAAACATT AATTCACAAT GTTGTTGTGT GTATAGGAAA TCAAACCCTT
Aggacccctt tgaatgaaag aaaaaaatat agaaatacta gaggatttgt attctatagt aaaaaaaatt gtttaagtcc
tctaaaataa aagattgatt cctaccagtt ttcttaaaat tcctatcgaa agggcttttc tatgagaatt tgggagaaaa
ataatcatga agtgagacct caggttttct tcttctctaa tgctgtacta tttcctatgt gccattcaaa AAAAAAGTTT
CGACACTTGT CGGTGTTTCT AAATACTATA GAAATCCAAT GGACATAACA TTCTATTCCT AAATACCGAA ATCCAATGTA
CATAATATTT TGTTTCTACA TGTCTAACAT AGAAAAAAAA TAGTTCACCA TAGATGTGAG AATCAGTGTT AAAATTTAAA
CCCAGGTAGA CAGGTTTAAA AAAGAAAAAA TCTTAGTATA ATCCATTGAG CTAAGCTCAA TTCGCACGAC ATCGTCCGCT
TCTCGCGAGT GTAGTTTACA TCCCCCCGTG CCGCGCATGG TGTCTCGTGT GGCCACTTGT TGGGTTGCAT CCATCCATTC
AAACCAAACC ACGCGCCCCA CCACCCGCTC TCTTCAACCC ATCCACCGCG TACGTACGTA CTTATATCCG TACTCTGAGC
ACGCTGCGTC GCGTGCTCAG AGTCATCATG TACCGGGGCC GGGTAGATAT CGATCATGGC AGTGTCGGAT CATCATTGCG
GCGGTGGCCG GAGCTGGCGG TTTCGTGGTG GCGTGCGGCG TGCTCAGCCG GTGCGTCAAG GCCGAGGCGG CGGCGGCGGC
GGCGAACGGT CGCCGCCACC ACCACCACCA CCACACCACG ATGCTCCTCA TGCCGGGAGC CGACGTCGAG CCGGACGTGA
GGGAggaggc ggctgcggcg gcgcagctga agatcatgta cggcgggcgg atgctggtgt tcgacgactt cttccccgcg
gggggcgcgg tcgtcgagct ggtgcgcgcc gcggcgcgcg ctgggcggga cgacgacggc gcgcgggcgc gacgccggcc
tgccggtggt gaggaaggtg tcgctgcagc ggtccgtgga gAAGAGAAGT CGCAGGCGGC TCGGGGCGAC GGCGCCGTAC
ATACTCGCCA TTCGCCGCCA ATGCTGCCGG CAAGGACGCC GGGATCAGGC CGCACTGACG ACGCCGCGTT CTACTGA

Locus: Os10g0391801

Loading...

Locus: Os10g0391801

Loading...