Os10t0397400-01

Locus

Os10g0397400

Description

Dim/dwf1 protein, Cell elongation protein DIMINUTO/Dwarf1, Brassinosteroid (BR) biosynthesis

RAP-DB Gene Symbol Synonym(s)

BRD2, brd2, OsBRD2, Dim/dwf1, Dim, dwf1

RAP-DB Gene Name Synonym(s)

BRASSINOSTEROID DEFICIENT DWARF 2, brassinosteroid (BR)-deficient dwarf-2, BR-deficient dwarf2, brassinosteroid-deficient dwarf2, rice homolog of Arabidopsis thaliana DIMINUTO/DWARF1, Dim/dwf1 protein, DIMINUTO, DWARF1, Putative Cell elongation protein DIMINUTO, Cell elongation protein Dwarf1

CGSNL Gene Symbol

BRD2

CGSNL Gene Name

BRASSINOSTEROID DEFICIENT DWARF 2

Oryzabase Gene Symbol Synonym(s)

brd2, OsBRD2, Dim/dwf1, Dim, dwf1, OsDWF1, DWF1, LTBSG1, OsLTBSG1

Oryzabase Gene Name Synonym(s)

brassinosteroid (BR)-deficient dwarf-2, BR-deficient dwarf2, brassinosteroid-deficient dwarf2, rice homolog of Arabidopsis thaliana DIMINUTO/DWARF1, Dim/dwf1 protein, DIMINUTO, DWARF1, Putative Cell elongation protein DIMINUTO, Cell elongation protein Dwarf1, Dimunito/Dwarf1, longer top branch and shorter grain 1

Transcript Evidence

Inferred from literature

Protein Evidence

Q8RU48

Literature

PMID: 15994910

PMID: 18980660

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

December 8, 2015

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on CH-OH group of donors (GO:0016614)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Functional domain (InterPro)

FAD-binding, type 2 (IPR016166)

FAD linked oxidase, N-terminal (IPR006094)

CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 (IPR016169)

Full-length cDNA

001-026-C04 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0397400-01)

RiceXPro (AK111949)

Others

Oryzabase (6017)

KEGG (Os10t0397400-01)

Transcript

2300 bp

>Os10t0397400-01 Dim/dwf1 protein, Cell elongation protein DIMINUTO/Dwarf1, Brassinosteroid (BR) biosynthesis
AAAGAGTCATTTCCGCGTATTTCTCGCCCGTTCGCCATCTCTTGTCGTGTAGTACCGCCG
AAAAGGAATTTCCCTTTCCGCCCCTGCGCTGTGCGCTCCACTCCACTACTTGAGTCCCCC
ATCCCCAGACTCCGCCACCACCACCTCCGGCTCCCCACCCCGACCAGCGGCGCCAGAGCA
GAGGCAGTGAGGCCGAGCTCCTCGCCTCGCCTCGCCGTCTCCGCCCGCGCGGCGCTGCCG
CCGAGCCGCCGCCGGCCTCCTCCTCCTCCTCCTTCCCGGTTCGGATCGGGCCCAAGAGCC
GGACTGCAGCCATGGCAGATCTGCAGGAGCCCCTCGTTCGTCCGAAGAGGAAGAAGGTTT
TGGTGGACTACTTGGTAAAGTTCCGATGGATTCTGGTGATCTTTGTGGTGCTCCCCATTT
CCGCTCTGATCTACTTCAATATCTATTTGGGCGATGTCTGGTCTGCCATGAAATCTGAGA
AACGTCGCCAGAAGGAACATGATGACAATGTGCAAAAAGTTGTGAAGCGGCTCAAGCAGA
GGAACCCAAAGAAGGATGGCCTTGTTTGCACAGCTAGGAAGCCCTGGATTGCTGTTGGCA
TGCGCAATGTAGACTACAAGCGTGCTAGGCATTTTGAGGTTGACCTTTCCGCCTTCAGGA
ACATTCTTGAGATTGACAGAGAGAGAATGGTTGCCAAGGTTGAGCCTCTTGTCAACATGG
GCCAGATAACCAGAGCTACATGCCCAATGAACCTTGCCCTTGCAGTTGTTGCTGAGCTTG
ATGACCTTACTGTTGGGGGACTGATCAATGGGTATGGTATTGAAGGGAGCTCTCACCTCT
ATGGTCTTTTCTCTGACACTGTTGTCGCCGTGGAAGTTGTTCTTGCAGACGGTCGAGTTG
TTAGAGCCACTAAGGATAATGAGTACTCTGACCTTTTCTATGGCATTCCCTGGTCCCAGG
GAACACTTGGGTTTCTTGTTTCCGCTGAGATCAAACTCATTCCCATCAAGGAATACATGA
GGCTCACATATACTCCAGTTAAAGGGTCACTGAAGGAGATAGCACAAGGTTATTGTGATT
CGTTTGCACCACGAGATGGTGATCCTGCAAAGGTCCCAGACTTCGTTGAGGGAATGGTGT
ACACAGAAAATGAGGGTGTCATGATGACTGGTGTTTATGCTTCCAAAGAAGAGGCAAAGA
AGAAGGGCAATAAGATCAACTGTGTCGGGTGGTGGTTCAAGCCTTGGTTTTACCAACATG
CTCAGACAGCACTCAAGAAGGGTGAGTTTGTGGAGTACATTCCAACAAGAGAGTACTACC
ACCGTCACACCCGGTGTCTGTACTGGGAGGGGAAGCTGATCTTGCCATTCGGCGACCAAT
TCTGGTTCAGGTTCCTCTTGGGCTGGCTGATGCCACCAAAGGTGTCTCTGCTCAAGGCCA
CACAGGGTGAATCTATCAGGAATTACTACCATGACAACCATGTGATTCAAGACATGCTGG
TTCCCTTGTACAAAGTTGGAGATGCTCTTGAGTTTGTTCACAAGGAAATGGAGGTTTATC
CACTGTGGCTGTGCCCGCACCGGCTCTACAAGCTCCCTGTGAAAACCATGGTGTACCCAG
AGCCTGGCTTTGAGCACCACCACAGGCAAGGTGACACTAGCTATGCCCAGATGTTCACCG
ATGTTGGTGTGTACTATGCTCCTGGTGCTGTCCTGAGGGGCGAGGAGTTCAATGGCGCTC
TAGCTGTCCACAGGCTGGAGCAGTGGCTGATTGAGAACCACAGCTACCAGCCACAGTACG
CTGTATCTGAGCTCAACGAGAAGGACTTCTGGAGGATGTTTGATGCTTCTCACTACGAGC
ATTGCCGCCAAAAGTATGGTGCCGTCGGTACCTTTATGAGCGTCTACTACAAGTCCAAGA
AGGGAAGGAAGACTGAGAAGGAGGTGCAGGAAGCCGAGGCCGCCATCCTCGAGCCAGCCT
ACGCTGATGAGGCGTAATTTCGTTGAGACCTTTGATGGTTTAGTCGTCCGGGTTTTCTCC
CCATTCCAAATGGGATTTTTCATCTGAACTATCCTTTTGCTTAGAACTTGATGTGCAGTG
TTTGTAGCACTTTGTAATCCTGTCATCGTCGTCCGTCTGCTCTTGGTACTTCTTTCACCC
TTGATCAAGTTGCTGAACTTAGTCAGGACTTAAGTGGTATTTAACCCAAGATCTGAATAA
TTTTGTGGCTACTGGACTAGTTAATTTCCTCAGCTATTAATTTGAGCTGTAGCATCAGAT
GAGGTGAACTTTAGCAATTG

CDS

1686 bp

>Os10t0397400-01 Dim/dwf1 protein, Cell elongation protein DIMINUTO/Dwarf1, Brassinosteroid (BR) biosynthesis
ATGGCAGATCTGCAGGAGCCCCTCGTTCGTCCGAAGAGGAAGAAGGTTTTGGTGGACTAC
TTGGTAAAGTTCCGATGGATTCTGGTGATCTTTGTGGTGCTCCCCATTTCCGCTCTGATC
TACTTCAATATCTATTTGGGCGATGTCTGGTCTGCCATGAAATCTGAGAAACGTCGCCAG
AAGGAACATGATGACAATGTGCAAAAAGTTGTGAAGCGGCTCAAGCAGAGGAACCCAAAG
AAGGATGGCCTTGTTTGCACAGCTAGGAAGCCCTGGATTGCTGTTGGCATGCGCAATGTA
GACTACAAGCGTGCTAGGCATTTTGAGGTTGACCTTTCCGCCTTCAGGAACATTCTTGAG
ATTGACAGAGAGAGAATGGTTGCCAAGGTTGAGCCTCTTGTCAACATGGGCCAGATAACC
AGAGCTACATGCCCAATGAACCTTGCCCTTGCAGTTGTTGCTGAGCTTGATGACCTTACT
GTTGGGGGACTGATCAATGGGTATGGTATTGAAGGGAGCTCTCACCTCTATGGTCTTTTC
TCTGACACTGTTGTCGCCGTGGAAGTTGTTCTTGCAGACGGTCGAGTTGTTAGAGCCACT
AAGGATAATGAGTACTCTGACCTTTTCTATGGCATTCCCTGGTCCCAGGGAACACTTGGG
TTTCTTGTTTCCGCTGAGATCAAACTCATTCCCATCAAGGAATACATGAGGCTCACATAT
ACTCCAGTTAAAGGGTCACTGAAGGAGATAGCACAAGGTTATTGTGATTCGTTTGCACCA
CGAGATGGTGATCCTGCAAAGGTCCCAGACTTCGTTGAGGGAATGGTGTACACAGAAAAT
GAGGGTGTCATGATGACTGGTGTTTATGCTTCCAAAGAAGAGGCAAAGAAGAAGGGCAAT
AAGATCAACTGTGTCGGGTGGTGGTTCAAGCCTTGGTTTTACCAACATGCTCAGACAGCA
CTCAAGAAGGGTGAGTTTGTGGAGTACATTCCAACAAGAGAGTACTACCACCGTCACACC
CGGTGTCTGTACTGGGAGGGGAAGCTGATCTTGCCATTCGGCGACCAATTCTGGTTCAGG
TTCCTCTTGGGCTGGCTGATGCCACCAAAGGTGTCTCTGCTCAAGGCCACACAGGGTGAA
TCTATCAGGAATTACTACCATGACAACCATGTGATTCAAGACATGCTGGTTCCCTTGTAC
AAAGTTGGAGATGCTCTTGAGTTTGTTCACAAGGAAATGGAGGTTTATCCACTGTGGCTG
TGCCCGCACCGGCTCTACAAGCTCCCTGTGAAAACCATGGTGTACCCAGAGCCTGGCTTT
GAGCACCACCACAGGCAAGGTGACACTAGCTATGCCCAGATGTTCACCGATGTTGGTGTG
TACTATGCTCCTGGTGCTGTCCTGAGGGGCGAGGAGTTCAATGGCGCTCTAGCTGTCCAC
AGGCTGGAGCAGTGGCTGATTGAGAACCACAGCTACCAGCCACAGTACGCTGTATCTGAG
CTCAACGAGAAGGACTTCTGGAGGATGTTTGATGCTTCTCACTACGAGCATTGCCGCCAA
AAGTATGGTGCCGTCGGTACCTTTATGAGCGTCTACTACAAGTCCAAGAAGGGAAGGAAG
ACTGAGAAGGAGGTGCAGGAAGCCGAGGCCGCCATCCTCGAGCCAGCCTACGCTGATGAG
GCGTAA

Protein

562 aa

>Os10t0397400-01 Dim/dwf1 protein, Cell elongation protein DIMINUTO/Dwarf1, Brassinosteroid (BR) biosynthesis
MADLQEPLVRPKRKKVLVDYLVKFRWILVIFVVLPISALIYFNIYLGDVWSAMKSEKRRQ
KEHDDNVQKVVKRLKQRNPKKDGLVCTARKPWIAVGMRNVDYKRARHFEVDLSAFRNILE
IDRERMVAKVEPLVNMGQITRATCPMNLALAVVAELDDLTVGGLINGYGIEGSSHLYGLF
SDTVVAVEVVLADGRVVRATKDNEYSDLFYGIPWSQGTLGFLVSAEIKLIPIKEYMRLTY
TPVKGSLKEIAQGYCDSFAPRDGDPAKVPDFVEGMVYTENEGVMMTGVYASKEEAKKKGN
KINCVGWWFKPWFYQHAQTALKKGEFVEYIPTREYYHRHTRCLYWEGKLILPFGDQFWFR
FLLGWLMPPKVSLLKATQGESIRNYYHDNHVIQDMLVPLYKVGDALEFVHKEMEVYPLWL
CPHRLYKLPVKTMVYPEPGFEHHHRQGDTSYAQMFTDVGVYYAPGAVLRGEEFNGALAVH
RLEQWLIENHSYQPQYAVSELNEKDFWRMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRK
TEKEVQEAEAAILEPAYADEA*

5'UTR

chr10:13362930..13363225 (- strand) : 296 bp

chr10:13361875..13361889 (- strand) : 15 bp

CDS

chr10:13360633..13361874 (- strand) : 1242 bp

chr10:13359935..13360378 (- strand) : 444 bp

3'UTR

chr10:13359632..13359934 (- strand) : 303 bp

FASTA

>Os10t0397400-01 class=Sequence position=chr10:13359632..13363225 (- strand)
AAAGAGTCAT TTCCGCGTAT TTCTCGCCCG TTCGCCATCT CTTGTCGTGT AGTACCGCCG AAAAGGAATT TCCCTTTCCG
CCCCTGCGCT GTGCGCTCCA CTCCACTACT TGAGTCCCCC ATCCCCAGAC TCCGCCACCA CCACCTCCGG CTCCCCACCC
CGACCAGCGG CGCCAGAGCA GAGGCAGTGA GGCCGAGCTC CTCGCCTCGC CTCGCCGTCT CCGCCCGCGC GGCGCTGCCG
CCGAGCCGCC GCCGGCCTCC TCCTCCTCCT CCTTCCCGGT TCGGATCGGG CCCAAGGTAT ATGCCACTCG TCTTCTCTCC
CTCCTCCCCG CCGCTTCATG AGCCACCGGA GATTGCCTTG AGGGGATTTC TTCCCGCTCG GATCGACGGA TCCAGTCCCG
TTTCTTCCGG GTTCTTGCGG TGTAGAGTCG TAGTCGTAGT GGTAGTGTTG GTAGCGGCTT GTTTTTCGAG GGAGGGATTT
GGGGGGGTTT GGTTGGTTCG GGTTCTTGGG GAGGGTTTAG CTGAACCCGT GAGGTTTCTG AGGTCCCCGC CTGAACAGAT
CTGTGGTGTC TCCGTGTGGG AGCATGTTTT GCTGCGTGCG TGCGTGCGTG CATGCTAGCC ATGGATTGGT GCTCACGCCG
CATGCGTGAG CTTTGGGGGG GGGGGGGGGG TTCAGTTGTT GTTGGATTAT GTGAGCGAGA ACGCATGATA CGATGCAATG
CCGCGGTCCT TTTTGTTGTG ATGGGCAGCC TCACAGCATG CGTGCTGCGG CATTCACATG GACGTCGACA CCGTGTCGAT
TCTTTTTGTG TCTCTTGTTG TGTTGTGAAA TTTTTCATGA ATGGTGCAAG GTGGCGGTTG GTCTTGGATG TGGATGTTGA
GCTGGGAGGA TCAGTTATCC TACAAATTGC ATCTTAGTAG TACATATGTT GACATGGCAT TACTGATTCA CCCTCCTTTT
TTTGCTTCTG CATGTCATTG CCCTGTTACC CCTTAAAATA GGTTCTATTA TGGTATACCT ATCCAGTGTG CAAGAATGAT
ATGCCTTTGA CATTGTTGCG TCATCTTTAC TTGGTACTTT AGATGGTAAA ATGGAAGTGT GATGGATGTA ACTGTGTCAA
TACAGCGGAG AAGATATTAA TCAATAATCA TGTACATTTG TTGTTTTTGG CATCTTCTCA TGTAAAATCT TTTGGGTCTG
TTCTTGTTAT GTGCTTCACT TTCACTTTTA CTGTTTTTTT TTTAATTTTC AAGAAACATA CAGCTTCAGT GTGGTGATTG
ATAAAAATCA TTACTCTAAC TAATTCTGTT TTCTCCTCGA ACTGTTCTGT TCCTAGAGCC GGACTGCAGC CATGGCAGAT
CTGCAGGAGC CCCTCGTTCG TCCGAAGAGG AAGAAGGTTT TGGTGGACTA CTTGGTAAAG TTCCGATGGA TTCTGGTGAT
CTTTGTGGTG CTCCCCATTT CCGCTCTGAT CTACTTCAAT ATCTATTTGG GCGATGTCTG GTCTGCCATG AAATCTGAGA
AACGTCGCCA GAAGGAACAT GATGACAATG TGCAAAAAGT TGTGAAGCGG CTCAAGCAGA GGAACCCAAA GAAGGATGGC
CTTGTTTGCA CAGCTAGGAA GCCCTGGATT GCTGTTGGCA TGCGCAATGT AGACTACAAG CGTGCTAGGC ATTTTGAGGT
TGACCTTTCC GCCTTCAGGA ACATTCTTGA GATTGACAGA GAGAGAATGG TTGCCAAGGT TGAGCCTCTT GTCAACATGG
GCCAGATAAC CAGAGCTACA TGCCCAATGA ACCTTGCCCT TGCAGTTGTT GCTGAGCTTG ATGACCTTAC TGTTGGGGGA
CTGATCAATG GGTATGGTAT TGAAGGGAGC TCTCACCTCT ATGGTCTTTT CTCTGACACT GTTGTCGCCG TGGAAGTTGT
TCTTGCAGAC GGTCGAGTTG TTAGAGCCAC TAAGGATAAT GAGTACTCTG ACCTTTTCTA TGGCATTCCC TGGTCCCAGG
GAACACTTGG GTTTCTTGTT TCCGCTGAGA TCAAACTCAT TCCCATCAAG GAATACATGA GGCTCACATA TACTCCAGTT
AAAGGGTCAC TGAAGGAGAT AGCACAAGGT TATTGTGATT CGTTTGCACC ACGAGATGGT GATCCTGCAA AGGTCCCAGA
CTTCGTTGAG GGAATGGTGT ACACAGAAAA TGAGGGTGTC ATGATGACTG GTGTTTATGC TTCCAAAGAA GAGGCAAAGA
AGAAGGGCAA TAAGATCAAC TGTGTCGGGT GGTGGTTCAA GCCTTGGTTT TACCAACATG CTCAGACAGC ACTCAAGAAG
GGTGAGTTTG TGGAGTACAT TCCAACAAGA GAGTACTACC ACCGTCACAC CCGGTGTCTG TACTGGGAGG GGAAGCTGAT
CTTGCCATTC GGCGACCAAT TCTGGTTCAG GTTCCTCTTG GGCTGGCTGA TGCCACCAAA GGTGTCTCTG CTCAAGGCCA
CACAGGGTGA ATCTATCAGG AATTACTACC ATGACAACCA TGTGATTCAA GACATGCTGG TTCCCTTGTA CAAAGTTGGA
GATGCTCTTG AGTTTGTTCA CAAGGAAATG GAGGTGTGTT TCACTTCGGA TCGAATATTT GATGTTTAAG TATCAAATAT
GCATTTAAAA CGAGGCTTTT CAATTATATA ACTACTTCTA GAAATGAATA TTCCATGCCA TAAATTGTTA TGCTTGCACA
TGCATTCTAT TACTTATATC TTTGGGCTTG ATGTAAGTTC ACCTAACTAT TCTTGTGCCT GTACCAACTA TTTTAGTGTA
CTGCAATCTA CTGCTGCTTA CAGTTCACTA ATAATTTCTG TTATTAGGTT TATCCACTGT GGCTGTGCCC GCACCGGCTC
TACAAGCTCC CTGTGAAAAC CATGGTGTAC CCAGAGCCTG GCTTTGAGCA CCACCACAGG CAAGGTGACA CTAGCTATGC
CCAGATGTTC ACCGATGTTG GTGTGTACTA TGCTCCTGGT GCTGTCCTGA GGGGCGAGGA GTTCAATGGC GCTCTAGCTG
TCCACAGGCT GGAGCAGTGG CTGATTGAGA ACCACAGCTA CCAGCCACAG TACGCTGTAT CTGAGCTCAA CGAGAAGGAC
TTCTGGAGGA TGTTTGATGC TTCTCACTAC GAGCATTGCC GCCAAAAGTA TGGTGCCGTC GGTACCTTTA TGAGCGTCTA
CTACAAGTCC AAGAAGGGAA GGAAGACTGA GAAGGAGGTG CAGGAAGCCG AGGCCGCCAT CCTCGAGCCA GCCTACGCTG
ATGAGGCGTA ATTTCGTTGA GACCTTTGAT GGTTTAGTCG TCCGGGTTTT CTCCCCATTC CAAATGGGAT TTTTCATCTG
AACTATCCTT TTGCTTAGAA CTTGATGTGC AGTGTTTGTA GCACTTTGTA ATCCTGTCAT CGTCGTCCGT CTGCTCTTGG
TACTTCTTTC ACCCTTGATC AAGTTGCTGA ACTTAGTCAG GACTTAAGTG GTATTTAACC CAAGATCTGA ATAATTTTGT
GGCTACTGGA CTAGTTAATT TCCTCAGCTA TTAATTTGAG CTGTAGCATC AGATGAGGTG AACTTTAGCA ATTG