Os10t0410700-01

Locus

Os10g0410700

Description

Similar to SET domain protein 123.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET38, SDG741

Oryzabase Gene Name Synonym(s)

SET protein 38

Transcript Evidence

AK111981 (DDBJ, Best hit)

AK111906 (DDBJ, Best hit)

Protein Evidence

NP_001105199.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Full-length cDNA

001-009-E07 (Online Clone Ordering)

J033058P06 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0410700-01)

Others

Oryzabase (13401)

Transcript

1237 bp

>Os10t0410700-01 Similar to SET domain protein 123.
CTCAATCAGAATCAGCGGCTGAGATCTCTGCCAGCCGTCCACTCCATGTTCCACCACCTC
CGCCGCCGCCTCCTCTGCACCGCGGCGGCGCCGCCGATCCGCGTGGCGCTGACGGAGTCC
TCCGGCCGAGGGGTCTTCGCCACCCGCCCCATCTCCGCCGGCGAGGTCCTCCACTCCGCG
CAGCCCCTCGTCTCCCACCCTTCCCCTCCCCTCATCCACGAGGTGTGCTACAGCTGCCTC
AGGAGGAAGTCCGGGAGCGGCGGCGGCTCGAGCGGGAGCTGCTACTTCTGCAGCGACGCG
TGCAGGGAGCACGCCAAGGGATTCCATGGCGTTGAAAAGAAAGCGGATTGGTCTTTGTTT
GATGACCACTGCAGTTCACGCGGTCTAAAGTACCCGTACATGGCAAAGCGACTAGCTTGC
ATGGTTATCTCAGGAGCTGTTAGTGCAGACTGTCTTGACATACTCCAGCCAGCCCGTTTG
CACCAGGGGACACTTACAGAGATGGAGGAAGAGTTTGCGTTGTTGGATTCCACTTTTAGG
AAGGCAGGGTTTCAGGAAGAAATCACAACTTTTTTGACCAAAGAGTGGTACATCAATGTG
CTGGCAAGGATACGCATAAATGCATTCCGCATTGAACTGGTTGCAAGTTCATATGAGAAC
CTTCTATCCTCAGCAGTAGCCTCAGTATCTTGTGATGCGGCAGTTGGCAATGCTGTCTAT
ATGCTTCCCTCTTTCTATAACCATGACTGTGATCCAAATACTCACATAGTTTGGTTGGCC
AGCGCAGACGCGAGATTAAAGGCCCTCCGCAACATCGAAGAAGGTGAAGAGCTGCGCATC
TGCTACATTGACGCGAGCATGGACGTCGATGCCCGTCAGAGGATTCTCGCCGAAGGATTT
GGCTTCGAATGCCGCTGCCAACGGTGCTTGTCTGGAGATTAAAACACCATCCCTTTTTCG
TTGTATTTTCCATCCTTTTGGCATGCACATTGAAGCCAACCGAGGTTAATTACCATTGTA
AACTTTTCAAAGATCAGTTGAAGCCAGGAGTCACCAATGTAACTGCCAGGTGCTCCTGTT
TGGAAGATTTGTAACGTGTTGGTGTGTGTGTGTCGACAAGAGTACGAATACTGAATGTTG
TTGATTATTACCCCGATGTTTAAGCATTAGACTTTTGGACATTATTAGACATTTGTTTGA
CATGTTACTGCCATGCCAATAACATTGGTGTTTACAG

CDS

897 bp

>Os10t0410700-01 Similar to SET domain protein 123.
ATGTTCCACCACCTCCGCCGCCGCCTCCTCTGCACCGCGGCGGCGCCGCCGATCCGCGTG
GCGCTGACGGAGTCCTCCGGCCGAGGGGTCTTCGCCACCCGCCCCATCTCCGCCGGCGAG
GTCCTCCACTCCGCGCAGCCCCTCGTCTCCCACCCTTCCCCTCCCCTCATCCACGAGGTG
TGCTACAGCTGCCTCAGGAGGAAGTCCGGGAGCGGCGGCGGCTCGAGCGGGAGCTGCTAC
TTCTGCAGCGACGCGTGCAGGGAGCACGCCAAGGGATTCCATGGCGTTGAAAAGAAAGCG
GATTGGTCTTTGTTTGATGACCACTGCAGTTCACGCGGTCTAAAGTACCCGTACATGGCA
AAGCGACTAGCTTGCATGGTTATCTCAGGAGCTGTTAGTGCAGACTGTCTTGACATACTC
CAGCCAGCCCGTTTGCACCAGGGGACACTTACAGAGATGGAGGAAGAGTTTGCGTTGTTG
GATTCCACTTTTAGGAAGGCAGGGTTTCAGGAAGAAATCACAACTTTTTTGACCAAAGAG
TGGTACATCAATGTGCTGGCAAGGATACGCATAAATGCATTCCGCATTGAACTGGTTGCA
AGTTCATATGAGAACCTTCTATCCTCAGCAGTAGCCTCAGTATCTTGTGATGCGGCAGTT
GGCAATGCTGTCTATATGCTTCCCTCTTTCTATAACCATGACTGTGATCCAAATACTCAC
ATAGTTTGGTTGGCCAGCGCAGACGCGAGATTAAAGGCCCTCCGCAACATCGAAGAAGGT
GAAGAGCTGCGCATCTGCTACATTGACGCGAGCATGGACGTCGATGCCCGTCAGAGGATT
CTCGCCGAAGGATTTGGCTTCGAATGCCGCTGCCAACGGTGCTTGTCTGGAGATTAA

Protein

299 aa

>Os10t0410700-01 Similar to SET domain protein 123.
MFHHLRRRLLCTAAAPPIRVALTESSGRGVFATRPISAGEVLHSAQPLVSHPSPPLIHEV
CYSCLRRKSGSGGGSSGSCYFCSDACREHAKGFHGVEKKADWSLFDDHCSSRGLKYPYMA
KRLACMVISGAVSADCLDILQPARLHQGTLTEMEEEFALLDSTFRKAGFQEEITTFLTKE
WYINVLARIRINAFRIELVASSYENLLSSAVASVSCDAAVGNAVYMLPSFYNHDCDPNTH
IVWLASADARLKALRNIEEGEELRICYIDASMDVDARQRILAEGFGFECRCQRCLSGD*

5'UTR

chr10:14263829..14263873 (- strand) : 45 bp

CDS

chr10:14263652..14263828 (- strand) : 177 bp

chr10:14263449..14263544 (- strand) : 96 bp

chr10:14263045..14263100 (- strand) : 56 bp

chr10:14262743..14262869 (- strand) : 127 bp

chr10:14262561..14262630 (- strand) : 70 bp

chr10:14262233..14262412 (- strand) : 180 bp

chr10:14261769..14261840 (- strand) : 72 bp

chr10:14261516..14261634 (- strand) : 119 bp

3'UTR

chr10:14261221..14261515 (- strand) : 295 bp

FASTA

>Os10t0410700-01 class=Sequence position=chr10:14261221..14263873 (- strand)
CTCAATCAGA ATCAGCGGCT GAGATCTCTG CCAGCCGTCC ACTCCATGTT CCACCACCTC CGCCGCCGCC TCCTCTGCAC
CGCGGCGGCG CCGCCGATCC GCGTGGCGCT GACGGAGTCC TCCGGCCGAG GGGTCTTCGC CACCCGCCCC ATCTCCGCCG
GCGAGGTCCT CCACTCCGCG CAGCCCCTCG TCTCCCACCC TTCCCCTCCC CTCATCCACG AGGTGAGTTG CTCCGCTTTA
CTCGCCTCTT TGCCGCCGGC CACCGCGGCT GGAAACTCTA CCTTCTCCTT TTACGGACGG AGCGAAATGG TTCGGATTGG
GCTCCTCAGG TGTGCTACAG CTGCCTCAGG AGGAAGTCCG GGAGCGGCGG CGGCTCGAGC GGGAGCTGCT ACTTCTGCAG
CGACGCGTGC AGGGAGCACG CCAAGGTGAG GCCTTAACAC CATTGATTTA TGTACTAGTA GTATAATGAC TTGTGATGCT
ACAAAATTTT CAAGATTCAG TGGATGTTAG TGTACTGTTC TTTTGTCATT TGCTCATTTC CAAGTTATTA CGATGCTGTA
TCAAGATCCA GTAGGTGTTT TGCAACAAAA TGTGAATGGT AGCCTTCCAT GGTCAGAGCA CATGAATGGC CAAAGGCTTG
CAATCTTTCA CAATAATGTT CCTTGAGGAA ATTACATGTT TATTTGTCCT CCCTTCGACA AGAAGATATA TCTGCAGAGG
GCAACCGAGG ATGGTGTTGT CTAACAAGGT GTGTGATTTT TTGGCCAATT TAGGGATTCC ATGGCGTTGA AAAGAAAGCG
GATTGGTCTT TGTTTGATGA CCACTGCAGG TATGTCTCTG TCCCCTTGTG TAGATGTGTG CATCCTGACC TCCGCATTGC
ATCTATGCTC ATGCTCTTGG GTTTTATTTT TACTTGTTAA TGCCATGGCG ATGCTATTTT GTTAAGCACG CAATTGTCTT
GGTGGCTTTT GACTTGAATT TATACTTTGC TTTTCTTCCT GAAGTTCACG CGGTCTAAAG TACCCGTACA TGGCAAAGCG
ACTAGCTTGC ATGGTTATCT CAGGAGCTGT TAGTGCAGAC TGTCTTGACA TACTCCAGCC AGCCCGTTTG CACCAGGGGA
CACTTACAGA GGTAGCTGCT TTATTTCAGA ACTATTGTTA ATTTCAGAAC ATAATCTTTT CAACTAATTC ATGTCCTGTA
ATGTTATTTG TCTGGTGCTT ACTTGAACAA TGTAATAATA TAGATGGAGG AAGAGTTTGC GTTGTTGGAT TCCACTTTTA
GGAAGGCAGG GTTTCAGGAA GAAATCACAA CTTGTATCCT TCATTTTTCT CACTTGTGTT ATTTATGGCC AAGCAGTGTT
GAACACTAAT ACTGATAAAG ATACGTAATA GAATGGATCG AATGCATATT TCAATCTCGC CCAACTTATC TTTTCTTATC
TATTTTTCTT TGACAAATTA GTTTTGACCA AAGAGTGGTA CATCAATGTG CTGGCAAGGA TACGCATAAA TGCATTCCGC
ATTGAACTGG TTGCAAGTTC ATATGAGAAC CTTCTATCCT CAGCAGTAGC CTCAGTATCT TGTGATGCGG CAGTTGGCAA
TGCTGTCTAT ATGCTTCCCT CTTTCTATAA CCATGACTGT GGTATGTCTT TTGACCTTGC GCTGTTGAAC TAAAGCAATA
TTTAACTTCC TTTTGCCTAC GGAATATTTA AACAGTGTGT CTTGCCATGA GATACAAGAA TTTGTTATTG CCTTTTTGTT
GTGATGCAGT AAATGGTGAC TGTTATTTCT AAATTCTTCA TTAGCATATG TTTATATCTA GTATTGACTG ATTGGTTTAC
CGAAATTATT CTCGTCGACT TAATATCATC GAGTTTTGTG GAACCTTTTG GTTATTAATC ACTTTAGATA ATTAGAAAAC
AAAAGTCGTT TCATTCCGAG TAATTTTTTT TTACTTGGAT CAATATTATC GCGCTTATTT TTCTTTGAAA TTTGAGACCC
AATCACTCAC CATCTCCCAT TATTAACTTT CAGATCCAAA TACTCACATA GTTTGGTTGG CCAGCGCAGA CGCGAGATTA
AAGGCCCTCC GCAACATCGA AGAAGGTACG TAAATCTGCG GTGCGCTGGC CCAGTTATTC TATCACCAGC CATTGAGCGC
AGTTGAACAG AAAGACAAAC ACACCGATGG CTGCCAAAAT TGTTGATACT GTGGATGTTG CATCTGCTAT ATACTACAGG
TGAAGAGCTG CGCATCTGCT ACATTGACGC GAGCATGGAC GTCGATGCCC GTCAGAGGAT TCTCGCCGAA GGATTTGGCT
TCGAATGCCG CTGCCAACGG TGCTTGTCTG GAGATTAAAA CACCATCCCT TTTTCGTTGT ATTTTCCATC CTTTTGGCAT
GCACATTGAA GCCAACCGAG GTTAATTACC ATTGTAAACT TTTCAAAGAT CAGTTGAAGC CAGGAGTCAC CAATGTAACT
GCCAGGTGCT CCTGTTTGGA AGATTTGTAA CGTGTTGGTG TGTGTGTGTC GACAAGAGTA CGAATACTGA ATGTTGTTGA
TTATTACCCC GATGTTTAAG CATTAGACTT TTGGACATTA TTAGACATTT GTTTGACATG TTACTGCCAT GCCAATAACA
TTGGTGTTTA CAG

Locus: Os10g0410700

Loading...

Locus: Os10g0410700

Loading...