Os10t0419500-01

Locus

Os10g0419500

Description

Acireductone dioxygenase, Promotion of crown/lateral root development, Modulation of the root growth pattern

RAP-DB Gene Symbol Synonym(s)

OsARD4

RAP-DB Gene Name Synonym(s)

acireductone dioxygenase 4

CGSNL Gene Symbol

ARD4

CGSNL Gene Name

ACIREDUCTONE DIOXYGENASE 4

Oryzabase Gene Symbol Synonym(s)

OsARD4

Oryzabase Gene Name Synonym(s)

acireductone dioxygenase 4

Transcript Evidence

AK071316

Protein Evidence

Q7XEJ5

Literature

PMID: 30356087

Note

Manual Curation

October 31, 2018

Gene Ontology (GO)

Biological Process: L-methionine salvage from methylthioadenosine (GO:0019509)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: acireductone dioxygenase [iron(II)-requiring] activity (GO:0010309)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

RmlC-like jelly roll fold (IPR014710)

RmlC-like cupin domain superfamily (IPR011051)

Acireductone dioxygenase ARD family (IPR004313)

1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, eukaryotes (IPR027496)

Full-length cDNA

J023083J21 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0419500-01)

RiceXPro (AK071316)

Others

Oryzabase (22659)

KEGG (Os10t0419500-01 (EC:1.13.11.53 EC:1.13.11.54))

Transcript

1124 bp

>Os10t0419500-01 Acireductone dioxygenase, Promotion of crown/lateral root development, Modulation of the root growth pattern
AGTGTTCCAGGGATCTGCAATCTGTTGCTCTCCACTCACCCGACTCCAAATCAACTCCGC
AACCTCCCTGTGGCTCTCTTCCCATCACCAATCTCCGCCACAATCCGCTCACAAGAACAC
GACGAATTCGAGCAGGACAATCTTTGGTTTCTGGAACCAACCAGTAATCCATCCTCCTCA
TCGATATATACTCCATACACGTCCGGGCAAGCAGAAACCAAAACGGAAAAGCTCTCGGAT
TTCCCCGTCCCCATCTCGTTCTGTTCCCACTAGCCATGGCTCATCTGGTATGGATGCTGG
GGGAGAACGGAGAGGAGAAGAGCTTCGAGAATCCCAACGAGTTGCTGCCACTCTCCAGAC
TTGAAGAGATCGGTGTGTTGTATTGGCACTTGGATCCTAAGAAGTCTGAAAGCGAAGAAG
AGCTCACAAAAATCCGCAGAGAAAGAGGATACAGCTACTTTGATCTTACTGAGATATGCC
CTGATAAATTGGAAAATTATGAGGAGAAGCTGAAGAGCTTCTATTGTGAGCACATTCATG
CTGATGAAGAGATCCGGTACTGCTTGGAGGGTAGCGGTTACTTTGATGTCCGTGACAAGG
ATGACAAATGGATTCGGATTTGGATAAAAGAGGGAGACATGATCATCCTGCCAGCTGGGA
TTTATCATCGGTTCATCGTCGACAGCAACAACTATATCAAGCTCATGAGGCTCTTCATTG
GAGAACCAGTCTGGACCGCATACAACCGGCCACAGGAAGACCATCCTGTGAGGCAAGAGT
ATGTCAAGAATGTGAAGGGGGACACCGGATTTGCTCTTGCCGCACATTGAGTTTGCTGAA
TTGGGGGCTCACTATACAACTGTCCTATACATCACACTACTCATGAAATCATGAACCCAT
GCTGTTTTTATCATGAATCATGAAAACACATATGCAGTACACTTGAAAACTATCATATGT
AGTACTACTATCCGGCTATCCTACAAAAATTTTAGTACTACTTGAAACATTGCAGTATAC
ACAGTGACTGGTCCTGTACTCTTGTGCAATGTACTACACCAAAAATTGTCTATAACAAGT
CGGTTGGATACCCTAATGAAAATATTGCTCTGTATTCCATTTGG

CDS

555 bp

>Os10t0419500-01 Acireductone dioxygenase, Promotion of crown/lateral root development, Modulation of the root growth pattern
ATGGCTCATCTGGTATGGATGCTGGGGGAGAACGGAGAGGAGAAGAGCTTCGAGAATCCC
AACGAGTTGCTGCCACTCTCCAGACTTGAAGAGATCGGTGTGTTGTATTGGCACTTGGAT
CCTAAGAAGTCTGAAAGCGAAGAAGAGCTCACAAAAATCCGCAGAGAAAGAGGATACAGC
TACTTTGATCTTACTGAGATATGCCCTGATAAATTGGAAAATTATGAGGAGAAGCTGAAG
AGCTTCTATTGTGAGCACATTCATGCTGATGAAGAGATCCGGTACTGCTTGGAGGGTAGC
GGTTACTTTGATGTCCGTGACAAGGATGACAAATGGATTCGGATTTGGATAAAAGAGGGA
GACATGATCATCCTGCCAGCTGGGATTTATCATCGGTTCATCGTCGACAGCAACAACTAT
ATCAAGCTCATGAGGCTCTTCATTGGAGAACCAGTCTGGACCGCATACAACCGGCCACAG
GAAGACCATCCTGTGAGGCAAGAGTATGTCAAGAATGTGAAGGGGGACACCGGATTTGCT
CTTGCCGCACATTGA

Protein

185 aa

>Os10t0419500-01 Acireductone dioxygenase, Promotion of crown/lateral root development, Modulation of the root growth pattern
MAHLVWMLGENGEEKSFENPNELLPLSRLEEIGVLYWHLDPKKSESEEELTKIRRERGYS
YFDLTEICPDKLENYEEKLKSFYCEHIHADEEIRYCLEGSGYFDVRDKDDKWIRIWIKEG
DMIILPAGIYHRFIVDSNNYIKLMRLFIGEPVWTAYNRPQEDHPVRQEYVKNVKGDTGFA
LAAH*

5'UTR

chr10:14759489..14759763 (- strand) : 275 bp

CDS

chr10:14759477..14759488 (- strand) : 12 bp

chr10:14759292..14759370 (- strand) : 79 bp

chr10:14758438..14758532 (- strand) : 95 bp

chr10:14758107..14758346 (- strand) : 240 bp

chr10:14757421..14757549 (- strand) : 129 bp

3'UTR

chr10:14757127..14757420 (- strand) : 294 bp

FASTA

>Os10t0419500-01 class=Sequence position=chr10:14757127..14759763 (- strand)
AGTGTTCCAG GGATCTGCAA TCTGTTGCTC TCCACTCACC CGACTCCAAA TCAACTCCGC AACCTCCCTG TGGCTCTCTT
CCCATCACCA ATCTCCGCCA CAATCCGCTC ACAAGAACAC GACGAATTCG AGCAGGACAA TCTTTGGTTT CTGGAACCAA
CCAGTAATCC ATCCTCCTCA TCGATATATA CTCCATACAC GTCCGGGCAA GCAGAAACCA AAACGGAAAA GCTCTCGGAT
TTCCCCGTCC CCATCTCGTT CTGTTCCCAC TAGCCATGGC TCATCTGGTG GGTGCAAGAG CAAGATCGAT TTTTTTTTTT
GGTTCTTGCA AATCTTGGTG ATTTTGCGGC GTGCTGATGT GGTGGGTGGT TATGGTGTTG GTTCTTGGAT TAGGTATGGA
TGCTGGGGGA GAACGGAGAG GAGAAGAGCT TCGAGAATCC CAACGAGTTG CTGCCACTCT CCAGACTTGA AGGTGATGAC
AGTAATCCCG TATCTCCCGT TATTCTTTCT TTTTATTCGG GAAAGAAAAG GATGATTCGT GGAGGCACTA GAAATCATCA
TCTACTTGTT GATTTCCTGG GTTCTTGAGA CCTCTTCCTG GTGAAGAAAT TTAGTCAGAG ATGATTTTCT GACCAAATGC
CCCCTTTTTG GGATGGGATG AGAGGTATAT TGTGAGTTTC ACCTGCTGAT TGTTGCTATG CTCTTATATG CAACTGGTTG
AAGAGAGGCA CATGATTCAA CTGGGCAAAC CATACAATGC TACCTTGAGA TTTGGATCTG AGCAACTGTG GTGAATTTAG
TTTGTGTGGT CAAATTCTAA CCTGTTTCTC AAAGATTAAT TGTCTTTAGC AAATTATGTA CTGCTATTGT CAACAAGAGA
TTCCTCTGAA GTCTGAATGC GTGCTGCAAT AGCCTGTCAA AAACTGAACA ACTGTTTACA ATCTGGGAAA ATACAAACAG
GATGGCAGAC AAAGGAGGAG ATACATTACA GCTTATCTAC AACCAACTTC AGTTAGCTAG GGGATTTGAT CCTACCTAAC
GCTGTCTGCA AGTTGTTTAA CATACCCCAT CAATGTAAAT AGTCAGATAG TATGAACTAA CCATTGTTCT TAACTTCTTG
AGCCTGTAGC GATATAACTT AGTAAAGCAG TTGACCAAAT TGTTCGAGAA TCTGGCCTGT TTTTGTGCTA GACCTGTTCT
ACTGTGCAAC TTACTGACCC TATTTTTGCA GAGATCGGTG TGTTGTATTG GCACTTGGAT CCTAAGAAGT CTGAAAGCGA
AGAAGAGCTC ACAAAAATCC GCAGAGAAAG AGGATACAGC TACTTTGTAT GGAACTAACC CCTCAAGAGC TGCAATTTCC
TTTTGTCCAT CCCTCTGCTG TGCACCAATT AATATGTGCT GTATTGCTTT TTCTTAGGAT CTTACTGAGA TATGCCCTGA
TAAATTGGAA AATTATGAGG AGAAGCTGAA GAGCTTCTAT TGTGAGCACA TTCATGCTGA TGAAGAGATC CGGTACTGCT
TGGAGGGTAG CGGTTACTTT GATGTCCGTG ACAAGGATGA CAAATGGATT CGGATTTGGA TAAAAGAGGG AGACATGATC
ATCCTGCCAG CTGGGATTTA TCATCGGTTC ATCGTCGACA GCAACAACTA TATCAAGGTA GGAGCCACTA ATAATCTTTT
TTGTGTCACT GAATCACAGC TACACACAAC TCACACAACT GACTATCTGA CTTGCACGAT CAATTTCAGA ACTGGGACAA
AGGTAGCATA ATTTGAGGTT TAAGATTTAT GACATTTTGT AGAACTACAG AAAACTTTGA AATGTTCCAC GTCCCATAAC
TTTGTTGTCA ACACACTTGG TAATTAGCCT CTCTTATTCT AGTCATGTAA TCCTCATGGA CCAAGGGAAG AAAGAAGTAA
AACTAACTGT TATGGCCCCT ACGCAAATAT GATAACACCG ATCTAGCTAT GTGTGTAGAG AATGTATTGT TCACTCAATG
CTGAACATGC AGATATCTCA AAAGCTATAT CTCTAAATTT AACAAAACTA CTGAACTACA TAACTGGCAT TAAAACATAA
AACATGGTTC AGCTGGTACA GATTTGATAA CACTATAGTT TGAGAAAAAA AGTATGATAT CTCTTGTTTT AGAGTTTAAG
CAAAATATTT ATCTGAACCC TGGCCGATAC ATTCTGATCC TTTTACATTT GCAGCTCATG AGGCTCTTCA TTGGAGAACC
AGTCTGGACC GCATACAACC GGCCACAGGA AGACCATCCT GTGAGGCAAG AGTATGTCAA GAATGTGAAG GGGGACACCG
GATTTGCTCT TGCCGCACAT TGAGTTTGCT GAATTGGGGG CTCACTATAC AACTGTCCTA TACATCACAC TACTCATGAA
ATCATGAACC CATGCTGTTT TTATCATGAA TCATGAAAAC ACATATGCAG TACACTTGAA AACTATCATA TGTAGTACTA
CTATCCGGCT ATCCTACAAA AATTTTAGTA CTACTTGAAA CATTGCAGTA TACACAGTGA CTGGTCCTGT ACTCTTGTGC
AATGTACTAC ACCAAAAATT GTCTATAACA AGTCGGTTGG ATACCCTAAT GAAAATATTG CTCTGTATTC CATTTGG