Os10t0420600-00

Locus

Os10g0420600

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCAF1-17, OsCAF1M

Oryzabase Gene Name Synonym(s)

CCR4-associated factor 1-17, carbon catabolite repressor 4-associated factor 1-17, CCR4-associated factor 1M, carbon catabolite repressor 4-associated factor 1M

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os10t0420600-00)

Others

Oryzabase (18274)

Transcript

1944 bp

>Os10t0420600-00
ATGGTGTCCCCCAACATAGACAACCTCACCGCGAACACTTTCAGCATCACCATGCCGGCC
CATTACCCTGCTGTGGAATTCTACTACAACGGTGTAGGCGGTGAGCAGAACATCGAGGAA
TTCTACTACAACGGTGCAAGCACTGAGCAGAACATGGCGTTCCCCACCATGGACACACAC
GCAGCGAACATTTTCAGCTTCGATGCGTCAATCAATCACTCTGCTGAGGAATTCCGCCAA
ATCAGTGCAGGCGGCGAGCTGAACACGGTGTGCCCCAACATCGACACCCCCCTCGCCGCG
AATGCGTTCAGCTTCGTCGCGCCGGTCCATTACTCCGATGCCAATGCAGACCTCCATCTC
CATGTGGTGGATGCCGGCGGTGAGCAAGACACGGTGGCCGCCATTGTCGACGTGATCGGC
ATCCCAGCATCACCACCATCTCCAGCACCGGCAAGCATCACCAATGCCACCGTGAAGAGC
GTGTGGCGGGAGAACTACAGGGAGCAGTTCAAGCTCGTGGTCGACGCGCTCCACCAACCT
CGTCGCCACCTCTACATCGCCGTCGACATGGAGTTCGCCGCCGACGCCACCACCAACATC
CGCCGAAGGCCGGTAACCTCCACCGGTTGCTACCATCACCTGCGCGAGTTTGTGAATCGC
GGCGACATAGTCCAAATGGGGCTCGCGTTCGTGTTCGTCGGCGGCGGCGAACAATCCTCC
TCCTCCTCCTCGCCGCCGCCGATAACACTGGAGATCAACTTCAAAATCAACATCAAGGCG
CGCAAGTACAACAAGAAGTCGATCGCCTTCCTGTCCCGACAAGGCCATGATCTGAGGGAG
CACCGGAGGAGGGGCGTCTCGCCGCGGCGCTTCTACGAGGGGCTCCTGCGCCACCTCCCG
TTCGGCGATGGCCGCTCCGTCACATGGCTAGCTTACCACAGCGACTACGACCTGGGTTTC
CTCCTCCGCCTGCTGCAATGCGGAGGCCGCCGCCGCGGAGGCGGCGACCTCCCGCGTCAG
CTAGCCGCGTTTCTGCGCCGGCTACGGGAGAATTTCCCGGCGTTCTACGACGTCCGCGTG
ATCAGGCAGATGCTGGAGGATCATGGCTTCAGCGGGAAGCTCACCGGGCTCGCCGAGCAC
CTCGGAATCCGGCGTACCGGCGGCGCCGCGCACCATGCCGGCTCCGACGCGCTGCTGACA
CTGTCGTGTTTCTTCAAGATCTTCAGATCCCTCTCAGGACAGCAGCTGCATCAGCTGGAT
GCTCGGCGAGGGTTACTCGCTGGGTTAGAGGAGTGGAACATGGCGATCAAGTGCGCTCGC
CACATTGACGATCACACTAGAAACATCAAGGTGATCGAGGTGGTGGCAGAAAACTTGGAC
GAAGAGGCGCGACGAATCGGAGAGCTGGTTGCCAGCAACTTCAGCATCATTGGAGTAGAT
GTAAATCAGGTAGTAATCCATCCTCGATTGGGCAGGAAGGGTTATGAAATGATCATCGCG
TTCATGAACCCTGAAGGAATGTTGGCTTACGGGCGTGCCTGGAAATTCTGCATCAGTCGT
TTTACGTCAGACAACAATGGCAATGTACTGAATCTGAAACAGCTTGTTGAACTTATGCAA
TCTTGTGGAGCAACCAACAACCCTGATGTATCCTGGGTGACATTCCAGGGATCAGATGTG
ATCTACAGACTTATCAGGTCAGCCAATGGTGGTGTTATTCCTTCATTGATCAGCGGAGAG
AGCTACTTCCCTAGCTTGTATGATGTCGCATTGATCGTTGGTGGATTCCATGGCATCGGC
ACACTCGCTACAACTGATCGCAAAGTAGGTATTTTTGATGTTGCTCGAGCGCTGAAACTG
AAGGCCATCAAGGCCGACAAGGAGGCAGAGAGGGTTCTTCTTACTTTGAGATGCTTCATG
AGATTGGCAGAACTGATCCCCTGA

CDS

1944 bp

>Os10t0420600-00
ATGGTGTCCCCCAACATAGACAACCTCACCGCGAACACTTTCAGCATCACCATGCCGGCC
CATTACCCTGCTGTGGAATTCTACTACAACGGTGTAGGCGGTGAGCAGAACATCGAGGAA
TTCTACTACAACGGTGCAAGCACTGAGCAGAACATGGCGTTCCCCACCATGGACACACAC
GCAGCGAACATTTTCAGCTTCGATGCGTCAATCAATCACTCTGCTGAGGAATTCCGCCAA
ATCAGTGCAGGCGGCGAGCTGAACACGGTGTGCCCCAACATCGACACCCCCCTCGCCGCG
AATGCGTTCAGCTTCGTCGCGCCGGTCCATTACTCCGATGCCAATGCAGACCTCCATCTC
CATGTGGTGGATGCCGGCGGTGAGCAAGACACGGTGGCCGCCATTGTCGACGTGATCGGC
ATCCCAGCATCACCACCATCTCCAGCACCGGCAAGCATCACCAATGCCACCGTGAAGAGC
GTGTGGCGGGAGAACTACAGGGAGCAGTTCAAGCTCGTGGTCGACGCGCTCCACCAACCT
CGTCGCCACCTCTACATCGCCGTCGACATGGAGTTCGCCGCCGACGCCACCACCAACATC
CGCCGAAGGCCGGTAACCTCCACCGGTTGCTACCATCACCTGCGCGAGTTTGTGAATCGC
GGCGACATAGTCCAAATGGGGCTCGCGTTCGTGTTCGTCGGCGGCGGCGAACAATCCTCC
TCCTCCTCCTCGCCGCCGCCGATAACACTGGAGATCAACTTCAAAATCAACATCAAGGCG
CGCAAGTACAACAAGAAGTCGATCGCCTTCCTGTCCCGACAAGGCCATGATCTGAGGGAG
CACCGGAGGAGGGGCGTCTCGCCGCGGCGCTTCTACGAGGGGCTCCTGCGCCACCTCCCG
TTCGGCGATGGCCGCTCCGTCACATGGCTAGCTTACCACAGCGACTACGACCTGGGTTTC
CTCCTCCGCCTGCTGCAATGCGGAGGCCGCCGCCGCGGAGGCGGCGACCTCCCGCGTCAG
CTAGCCGCGTTTCTGCGCCGGCTACGGGAGAATTTCCCGGCGTTCTACGACGTCCGCGTG
ATCAGGCAGATGCTGGAGGATCATGGCTTCAGCGGGAAGCTCACCGGGCTCGCCGAGCAC
CTCGGAATCCGGCGTACCGGCGGCGCCGCGCACCATGCCGGCTCCGACGCGCTGCTGACA
CTGTCGTGTTTCTTCAAGATCTTCAGATCCCTCTCAGGACAGCAGCTGCATCAGCTGGAT
GCTCGGCGAGGGTTACTCGCTGGGTTAGAGGAGTGGAACATGGCGATCAAGTGCGCTCGC
CACATTGACGATCACACTAGAAACATCAAGGTGATCGAGGTGGTGGCAGAAAACTTGGAC
GAAGAGGCGCGACGAATCGGAGAGCTGGTTGCCAGCAACTTCAGCATCATTGGAGTAGAT
GTAAATCAGGTAGTAATCCATCCTCGATTGGGCAGGAAGGGTTATGAAATGATCATCGCG
TTCATGAACCCTGAAGGAATGTTGGCTTACGGGCGTGCCTGGAAATTCTGCATCAGTCGT
TTTACGTCAGACAACAATGGCAATGTACTGAATCTGAAACAGCTTGTTGAACTTATGCAA
TCTTGTGGAGCAACCAACAACCCTGATGTATCCTGGGTGACATTCCAGGGATCAGATGTG
ATCTACAGACTTATCAGGTCAGCCAATGGTGGTGTTATTCCTTCATTGATCAGCGGAGAG
AGCTACTTCCCTAGCTTGTATGATGTCGCATTGATCGTTGGTGGATTCCATGGCATCGGC
ACACTCGCTACAACTGATCGCAAAGTAGGTATTTTTGATGTTGCTCGAGCGCTGAAACTG
AAGGCCATCAAGGCCGACAAGGAGGCAGAGAGGGTTCTTCTTACTTTGAGATGCTTCATG
AGATTGGCAGAACTGATCCCCTGA

Protein

648 aa

>Os10t0420600-00
MVSPNIDNLTANTFSITMPAHYPAVEFYYNGVGGEQNIEEFYYNGASTEQNMAFPTMDTH
AANIFSFDASINHSAEEFRQISAGGELNTVCPNIDTPLAANAFSFVAPVHYSDANADLHL
HVVDAGGEQDTVAAIVDVIGIPASPPSPAPASITNATVKSVWRENYREQFKLVVDALHQP
RRHLYIAVDMEFAADATTNIRRRPVTSTGCYHHLREFVNRGDIVQMGLAFVFVGGGEQSS
SSSSPPPITLEINFKINIKARKYNKKSIAFLSRQGHDLREHRRRGVSPRRFYEGLLRHLP
FGDGRSVTWLAYHSDYDLGFLLRLLQCGGRRRGGGDLPRQLAAFLRRLRENFPAFYDVRV
IRQMLEDHGFSGKLTGLAEHLGIRRTGGAAHHAGSDALLTLSCFFKIFRSLSGQQLHQLD
ARRGLLAGLEEWNMAIKCARHIDDHTRNIKVIEVVAENLDEEARRIGELVASNFSIIGVD
VNQVVIHPRLGRKGYEMIIAFMNPEGMLAYGRAWKFCISRFTSDNNGNVLNLKQLVELMQ
SCGATNNPDVSWVTFQGSDVIYRLIRSANGGVIPSLISGESYFPSLYDVALIVGGFHGIG
TLATTDRKVGIFDVARALKLKAIKADKEAERVLLTLRCFMRLAELIP*

CDS

chr10:14802694..14804637 (- strand) : 1944 bp

FASTA

>Os10t0420600-00 class=Sequence position=chr10:14802694..14804637 (- strand)
ATGGTGTCCC CCAACATAGA CAACCTCACC GCGAACACTT TCAGCATCAC CATGCCGGCC CATTACCCTG CTGTGGAATT
CTACTACAAC GGTGTAGGCG GTGAGCAGAA CATCGAGGAA TTCTACTACA ACGGTGCAAG CACTGAGCAG AACATGGCGT
TCCCCACCAT GGACACACAC GCAGCGAACA TTTTCAGCTT CGATGCGTCA ATCAATCACT CTGCTGAGGA ATTCCGCCAA
ATCAGTGCAG GCGGCGAGCT GAACACGGTG TGCCCCAACA TCGACACCCC CCTCGCCGCG AATGCGTTCA GCTTCGTCGC
GCCGGTCCAT TACTCCGATG CCAATGCAGA CCTCCATCTC CATGTGGTGG ATGCCGGCGG TGAGCAAGAC ACGGTGGCCG
CCATTGTCGA CGTGATCGGC ATCCCAGCAT CACCACCATC TCCAGCACCG GCAAGCATCA CCAATGCCAC CGTGAAGAGC
GTGTGGCGGG AGAACTACAG GGAGCAGTTC AAGCTCGTGG TCGACGCGCT CCACCAACCT CGTCGCCACC TCTACATCGC
CGTCGACATG GAGTTCGCCG CCGACGCCAC CACCAACATC CGCCGAAGGC CGGTAACCTC CACCGGTTGC TACCATCACC
TGCGCGAGTT TGTGAATCGC GGCGACATAG TCCAAATGGG GCTCGCGTTC GTGTTCGTCG GCGGCGGCGA ACAATCCTCC
TCCTCCTCCT CGCCGCCGCC GATAACACTG GAGATCAACT TCAAAATCAA CATCAAGGCG CGCAAGTACA ACAAGAAGTC
GATCGCCTTC CTGTCCCGAC AAGGCCATGA TCTGAGGGAG CACCGGAGGA GGGGCGTCTC GCCGCGGCGC TTCTACGAGG
GGCTCCTGCG CCACCTCCCG TTCGGCGATG GCCGCTCCGT CACATGGCTA GCTTACCACA GCGACTACGA CCTGGGTTTC
CTCCTCCGCC TGCTGCAATG CGGAGGCCGC CGCCGCGGAG GCGGCGACCT CCCGCGTCAG CTAGCCGCGT TTCTGCGCCG
GCTACGGGAG AATTTCCCGG CGTTCTACGA CGTCCGCGTG ATCAGGCAGA TGCTGGAGGA TCATGGCTTC AGCGGGAAGC
TCACCGGGCT CGCCGAGCAC CTCGGAATCC GGCGTACCGG CGGCGCCGCG CACCATGCCG GCTCCGACGC GCTGCTGACA
CTGTCGTGTT TCTTCAAGAT CTTCAGATCC CTCTCAGGAC AGCAGCTGCA TCAGCTGGAT GCTCGGCGAG GGTTACTCGC
TGGGTTAGAG GAGTGGAACA TGGCGATCAA GTGCGCTCGC CACATTGACG ATCACACTAG AAACATCAAG GTGATCGAGG
TGGTGGCAGA AAACTTGGAC GAAGAGGCGC GACGAATCGG AGAGCTGGTT GCCAGCAACT TCAGCATCAT TGGAGTAGAT
GTAAATCAGG TAGTAATCCA TCCTCGATTG GGCAGGAAGG GTTATGAAAT GATCATCGCG TTCATGAACC CTGAAGGAAT
GTTGGCTTAC GGGCGTGCCT GGAAATTCTG CATCAGTCGT TTTACGTCAG ACAACAATGG CAATGTACTG AATCTGAAAC
AGCTTGTTGA ACTTATGCAA TCTTGTGGAG CAACCAACAA CCCTGATGTA TCCTGGGTGA CATTCCAGGG ATCAGATGTG
ATCTACAGAC TTATCAGGTC AGCCAATGGT GGTGTTATTC CTTCATTGAT CAGCGGAGAG AGCTACTTCC CTAGCTTGTA
TGATGTCGCA TTGATCGTTG GTGGATTCCA TGGCATCGGC ACACTCGCTA CAACTGATCG CAAAGTAGGT ATTTTTGATG
TTGCTCGAGC GCTGAAACTG AAGGCCATCA AGGCCGACAA GGAGGCAGAG AGGGTTCTTC TTACTTTGAG ATGCTTCATG
AGATTGGCAG AACTGATCCC CTGA

Locus: Os10g0420600

Loading...

Locus: Os10g0420600

Loading...