Os10t0421700-00

Locus

Os10g0421700

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCAF1-21, OsCAF1N

Oryzabase Gene Name Synonym(s)

CCR4-associated factor 1-21, carbon catabolite repressor 4-associated factor 1-21, CCR4-associated factor 1N, carbon catabolite repressor 4-associated factor 1N

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os10t0421700-00)

Others

Oryzabase (18278)

Transcript

2637 bp

>Os10t0421700-00
ATGCCGCCGACGACGGGTTTCACCTCGCCGGCGTGGGATGCCGCCGACGACGGGTTGCAC
CTCGCCGGCGTGGGCGGGAAGAAGCACAACTTGGTGCTTGACGCCGCCCCCGACGGATTG
CACCTCGCCGGCGTGGGCGGGAAGCAGCACAACTTGGTGCTCGACGCCGGCACGGGCAGG
AAGCAGCAGAAGTTGGTGCTCGAGGACGACGGGTTGCACCACACCGGCGCAGGCAGGAAG
CAGCAGAAGTTGGTGCTCGACGCCGCCAACGACGGGTTGCACCTCGCCGGCGTGGGCGGG
AAGCAGCACAACTTGGTGCTCGACGCCGCCGACGACGGGTTGCACCTCGCCGGTGTAGGC
GGGAAGCAGCACAACTTGGTGGTCGACGCCGGCGCGGGCGCGAAGCAGCAGAAGTTGGTG
CTCGACGCCGCCGACGACGGGTTGCACCTCGCCGGCGTGGGCGGGAAGCAGCACAACTTG
GTGCTCGACGCCGGCGCAGGCGGGAAGCAGCAGAAGTTGGTGCTCGACGCCGCCGACGAC
GGGTTGCACCTCGCCGGTGTGGGCTGGAAGCAGCACAACTTGGTGCTCGACGCCGGCGCG
GGCGGGAAGCAGCAGAAGTTGGTGCTCGACACCGCCGTCGACGTGTCGCAGCACACCGTC
GGGGGCGCGGAGCAGAACTTGCTGCTCGACAGCACTGATGACGGGTTGCACCACACCGGC
GCAGGCGGGGAGCAGAACTTGGTGATCGATGACGACATCGACGGGTCGAACCACACCGTC
GGGGGCGCGGAGCAAGACGATGGGTTGCACACCACCGGCGCTGGCTGGGAGCAGAACTTG
GTGCTCTGCACCGACGTCGACGGGTTGCTCCACACCGGCGCGGGCGGGGAGCAGAACATG
GTCTGCGACAACGTTGGCACCATCGTCTCCGGGTTGCACGACACTATCGCGCGTTGGGAG
AGGAACTTGGTGTTCGACGACGTCGGTACAGCCGTTCCCTGGTTGCGCCACACCGGCGTT
GATGGGAAGCAGAACTTGGTGTACCACCTCGCCACGGCCACCGTGCAGAGCGTGTGGCGG
GAGAATTGCATGGAGCAGTTCAAGCTCGTGCTGGAAGCGCTTCATCAACCTCATCGCCAC
CTCTATATCGCCGTCGACATGGAGTTCGCAGCGGACGCCGCCACCAACGTGAGCCATAGG
CCAGTAACCTCCATCAGCTGCTACCAACACATGCGCAGGTACGTGAACGGAGGTGGCATT
TTTCAGATGGGCCTCACATTTGCATTCGTCGGTGAAGGCGAACAAGCTCCCTCGCCGCTG
ATAGCACTGGAGATCAACTTCGACTTCAACGTCAATTCGCCAAAGTACCATGGCAAGTCG
ATAGATTTCCTATCCAGTCAAGGCCATGATCTCACGCAGCACAGCAAAAGAGGCGTCGCG
CCGGAGTTTGTTTACGAGGGGCTCCTGCGCCACCTCCCGTTCGGCGACGGCTCCGTCACC
TGGGTCGCCTTTCACGGCGACTATGACTTGGCTTTCCTCCTCCGCTTGCTGCAAGGGGGA
GACCATGGCGGCAATTGCCTCCTGCCGCCTAAGCTTGCCACCTTCCTGCAAAAAGTGCGG
GAGAAGTTCCCAGTCGTCTACGACGTGCGCGTCCTTGGGAAGCTGGTGAAGGATGGCTTC
AATGGGAGCCTCACCGCACTAGCTGAATACCTTGGAATTCCGCGTAACGGCGACGAACAC
CACGCCGGCTCCGACGCGCTGCTTACATTGTCCTGTTTCTTCAAGATCGTCAGCCTTTCA
GGTCACCAGATGCACCGCATGGATGCTCGGCGGGGATTGCTTGCTGGGTTGGAGGAGTGG
AACATGGCTATCAAATGTGCACGCCATATTGACAACCATACTGGAAGCATCTACGTTGTC
AAGATGCTACCACATAAGTTGGATGAAGAGGCAAGACGAATTGAAGAGCTGGTGGCCAGC
AACTTCAACATCGTTGGAGTAGAGGTAATCCATGCTCAATTGGGTAAGCGCTCCTACGCA
GTTGAAGCCCAACAAAATTATGAACTCATCAAGACATTTCTTAAGGATTCTGACTTGTAC
GAAATCATCGTCACATTTATGAACGCTGAAGGAATGTTGGCTTACAGTCGTGCCTGGAAA
TTCTGCATCAGTTCCAGGGCAGACAATGCCTGTGTGCATCCTCAACAGTTTGCTAAGTTT
ATGGCATCTTGTGGGGCATTGGGTGACCCCAACATATCTTGGGTGACATTTCACGGAGCA
CATGGGATCGCCAGGATGATCAGGTCATTCCTTTCTCCCCAAGACCTTCCAAGCCAATGG
TGTTCTTACATTGGACACCGGAGAGCATTCTTTCCTGCTATATACGATGTTGCATTGCTT
GTGCGTAGATCCTTTGACATCATCACAATTCCTTGGATTGAGTGCAAAGGAGGACTGCTC
GATGTTGCTCAAGCACTGAACCTGAAGGAAATTGAGGCTGACATGGAGGCAGCCAGGAAC
GCCCTGATTTCCCAGGCACAAAGATGGCTGTCCAAGGGCTGCTTAAGGAGAGTTGCTGTT
GGAAATGCCCAGCAAATTGCTGATGGATGGAGGATGCATGATCACTCGGTGTGGTAA

CDS

2637 bp

>Os10t0421700-00
ATGCCGCCGACGACGGGTTTCACCTCGCCGGCGTGGGATGCCGCCGACGACGGGTTGCAC
CTCGCCGGCGTGGGCGGGAAGAAGCACAACTTGGTGCTTGACGCCGCCCCCGACGGATTG
CACCTCGCCGGCGTGGGCGGGAAGCAGCACAACTTGGTGCTCGACGCCGGCACGGGCAGG
AAGCAGCAGAAGTTGGTGCTCGAGGACGACGGGTTGCACCACACCGGCGCAGGCAGGAAG
CAGCAGAAGTTGGTGCTCGACGCCGCCAACGACGGGTTGCACCTCGCCGGCGTGGGCGGG
AAGCAGCACAACTTGGTGCTCGACGCCGCCGACGACGGGTTGCACCTCGCCGGTGTAGGC
GGGAAGCAGCACAACTTGGTGGTCGACGCCGGCGCGGGCGCGAAGCAGCAGAAGTTGGTG
CTCGACGCCGCCGACGACGGGTTGCACCTCGCCGGCGTGGGCGGGAAGCAGCACAACTTG
GTGCTCGACGCCGGCGCAGGCGGGAAGCAGCAGAAGTTGGTGCTCGACGCCGCCGACGAC
GGGTTGCACCTCGCCGGTGTGGGCTGGAAGCAGCACAACTTGGTGCTCGACGCCGGCGCG
GGCGGGAAGCAGCAGAAGTTGGTGCTCGACACCGCCGTCGACGTGTCGCAGCACACCGTC
GGGGGCGCGGAGCAGAACTTGCTGCTCGACAGCACTGATGACGGGTTGCACCACACCGGC
GCAGGCGGGGAGCAGAACTTGGTGATCGATGACGACATCGACGGGTCGAACCACACCGTC
GGGGGCGCGGAGCAAGACGATGGGTTGCACACCACCGGCGCTGGCTGGGAGCAGAACTTG
GTGCTCTGCACCGACGTCGACGGGTTGCTCCACACCGGCGCGGGCGGGGAGCAGAACATG
GTCTGCGACAACGTTGGCACCATCGTCTCCGGGTTGCACGACACTATCGCGCGTTGGGAG
AGGAACTTGGTGTTCGACGACGTCGGTACAGCCGTTCCCTGGTTGCGCCACACCGGCGTT
GATGGGAAGCAGAACTTGGTGTACCACCTCGCCACGGCCACCGTGCAGAGCGTGTGGCGG
GAGAATTGCATGGAGCAGTTCAAGCTCGTGCTGGAAGCGCTTCATCAACCTCATCGCCAC
CTCTATATCGCCGTCGACATGGAGTTCGCAGCGGACGCCGCCACCAACGTGAGCCATAGG
CCAGTAACCTCCATCAGCTGCTACCAACACATGCGCAGGTACGTGAACGGAGGTGGCATT
TTTCAGATGGGCCTCACATTTGCATTCGTCGGTGAAGGCGAACAAGCTCCCTCGCCGCTG
ATAGCACTGGAGATCAACTTCGACTTCAACGTCAATTCGCCAAAGTACCATGGCAAGTCG
ATAGATTTCCTATCCAGTCAAGGCCATGATCTCACGCAGCACAGCAAAAGAGGCGTCGCG
CCGGAGTTTGTTTACGAGGGGCTCCTGCGCCACCTCCCGTTCGGCGACGGCTCCGTCACC
TGGGTCGCCTTTCACGGCGACTATGACTTGGCTTTCCTCCTCCGCTTGCTGCAAGGGGGA
GACCATGGCGGCAATTGCCTCCTGCCGCCTAAGCTTGCCACCTTCCTGCAAAAAGTGCGG
GAGAAGTTCCCAGTCGTCTACGACGTGCGCGTCCTTGGGAAGCTGGTGAAGGATGGCTTC
AATGGGAGCCTCACCGCACTAGCTGAATACCTTGGAATTCCGCGTAACGGCGACGAACAC
CACGCCGGCTCCGACGCGCTGCTTACATTGTCCTGTTTCTTCAAGATCGTCAGCCTTTCA
GGTCACCAGATGCACCGCATGGATGCTCGGCGGGGATTGCTTGCTGGGTTGGAGGAGTGG
AACATGGCTATCAAATGTGCACGCCATATTGACAACCATACTGGAAGCATCTACGTTGTC
AAGATGCTACCACATAAGTTGGATGAAGAGGCAAGACGAATTGAAGAGCTGGTGGCCAGC
AACTTCAACATCGTTGGAGTAGAGGTAATCCATGCTCAATTGGGTAAGCGCTCCTACGCA
GTTGAAGCCCAACAAAATTATGAACTCATCAAGACATTTCTTAAGGATTCTGACTTGTAC
GAAATCATCGTCACATTTATGAACGCTGAAGGAATGTTGGCTTACAGTCGTGCCTGGAAA
TTCTGCATCAGTTCCAGGGCAGACAATGCCTGTGTGCATCCTCAACAGTTTGCTAAGTTT
ATGGCATCTTGTGGGGCATTGGGTGACCCCAACATATCTTGGGTGACATTTCACGGAGCA
CATGGGATCGCCAGGATGATCAGGTCATTCCTTTCTCCCCAAGACCTTCCAAGCCAATGG
TGTTCTTACATTGGACACCGGAGAGCATTCTTTCCTGCTATATACGATGTTGCATTGCTT
GTGCGTAGATCCTTTGACATCATCACAATTCCTTGGATTGAGTGCAAAGGAGGACTGCTC
GATGTTGCTCAAGCACTGAACCTGAAGGAAATTGAGGCTGACATGGAGGCAGCCAGGAAC
GCCCTGATTTCCCAGGCACAAAGATGGCTGTCCAAGGGCTGCTTAAGGAGAGTTGCTGTT
GGAAATGCCCAGCAAATTGCTGATGGATGGAGGATGCATGATCACTCGGTGTGGTAA

Protein

879 aa

>Os10t0421700-00
MPPTTGFTSPAWDAADDGLHLAGVGGKKHNLVLDAAPDGLHLAGVGGKQHNLVLDAGTGR
KQQKLVLEDDGLHHTGAGRKQQKLVLDAANDGLHLAGVGGKQHNLVLDAADDGLHLAGVG
GKQHNLVVDAGAGAKQQKLVLDAADDGLHLAGVGGKQHNLVLDAGAGGKQQKLVLDAADD
GLHLAGVGWKQHNLVLDAGAGGKQQKLVLDTAVDVSQHTVGGAEQNLLLDSTDDGLHHTG
AGGEQNLVIDDDIDGSNHTVGGAEQDDGLHTTGAGWEQNLVLCTDVDGLLHTGAGGEQNM
VCDNVGTIVSGLHDTIARWERNLVFDDVGTAVPWLRHTGVDGKQNLVYHLATATVQSVWR
ENCMEQFKLVLEALHQPHRHLYIAVDMEFAADAATNVSHRPVTSISCYQHMRRYVNGGGI
FQMGLTFAFVGEGEQAPSPLIALEINFDFNVNSPKYHGKSIDFLSSQGHDLTQHSKRGVA
PEFVYEGLLRHLPFGDGSVTWVAFHGDYDLAFLLRLLQGGDHGGNCLLPPKLATFLQKVR
EKFPVVYDVRVLGKLVKDGFNGSLTALAEYLGIPRNGDEHHAGSDALLTLSCFFKIVSLS
GHQMHRMDARRGLLAGLEEWNMAIKCARHIDNHTGSIYVVKMLPHKLDEEARRIEELVAS
NFNIVGVEVIHAQLGKRSYAVEAQQNYELIKTFLKDSDLYEIIVTFMNAEGMLAYSRAWK
FCISSRADNACVHPQQFAKFMASCGALGDPNISWVTFHGAHGIARMIRSFLSPQDLPSQW
CSYIGHRRAFFPAIYDVALLVRRSFDIITIPWIECKGGLLDVAQALNLKEIEADMEAARN
ALISQAQRWLSKGCLRRVAVGNAQQIADGWRMHDHSVW*

CDS

chr10:14888979..14891495 (- strand) : 2517 bp

chr10:14888822..14888941 (- strand) : 120 bp

FASTA

>Os10t0421700-00 class=Sequence position=chr10:14888822..14891495 (- strand)
ATGCCGCCGA CGACGGGTTT CACCTCGCCG GCGTGGGATG CCGCCGACGA CGGGTTGCAC CTCGCCGGCG TGGGCGGGAA
GAAGCACAAC TTGGTGCTTG ACGCCGCCCC CGACGGATTG CACCTCGCCG GCGTGGGCGG GAAGCAGCAC AACTTGGTGC
TCGACGCCGG CACGGGCAGG AAGCAGCAGA AGTTGGTGCT CGAGGACGAC GGGTTGCACC ACACCGGCGC AGGCAGGAAG
CAGCAGAAGT TGGTGCTCGA CGCCGCCAAC GACGGGTTGC ACCTCGCCGG CGTGGGCGGG AAGCAGCACA ACTTGGTGCT
CGACGCCGCC GACGACGGGT TGCACCTCGC CGGTGTAGGC GGGAAGCAGC ACAACTTGGT GGTCGACGCC GGCGCGGGCG
CGAAGCAGCA GAAGTTGGTG CTCGACGCCG CCGACGACGG GTTGCACCTC GCCGGCGTGG GCGGGAAGCA GCACAACTTG
GTGCTCGACG CCGGCGCAGG CGGGAAGCAG CAGAAGTTGG TGCTCGACGC CGCCGACGAC GGGTTGCACC TCGCCGGTGT
GGGCTGGAAG CAGCACAACT TGGTGCTCGA CGCCGGCGCG GGCGGGAAGC AGCAGAAGTT GGTGCTCGAC ACCGCCGTCG
ACGTGTCGCA GCACACCGTC GGGGGCGCGG AGCAGAACTT GCTGCTCGAC AGCACTGATG ACGGGTTGCA CCACACCGGC
GCAGGCGGGG AGCAGAACTT GGTGATCGAT GACGACATCG ACGGGTCGAA CCACACCGTC GGGGGCGCGG AGCAAGACGA
TGGGTTGCAC ACCACCGGCG CTGGCTGGGA GCAGAACTTG GTGCTCTGCA CCGACGTCGA CGGGTTGCTC CACACCGGCG
CGGGCGGGGA GCAGAACATG GTCTGCGACA ACGTTGGCAC CATCGTCTCC GGGTTGCACG ACACTATCGC GCGTTGGGAG
AGGAACTTGG TGTTCGACGA CGTCGGTACA GCCGTTCCCT GGTTGCGCCA CACCGGCGTT GATGGGAAGC AGAACTTGGT
GTACCACCTC GCCACGGCCA CCGTGCAGAG CGTGTGGCGG GAGAATTGCA TGGAGCAGTT CAAGCTCGTG CTGGAAGCGC
TTCATCAACC TCATCGCCAC CTCTATATCG CCGTCGACAT GGAGTTCGCA GCGGACGCCG CCACCAACGT GAGCCATAGG
CCAGTAACCT CCATCAGCTG CTACCAACAC ATGCGCAGGT ACGTGAACGG AGGTGGCATT TTTCAGATGG GCCTCACATT
TGCATTCGTC GGTGAAGGCG AACAAGCTCC CTCGCCGCTG ATAGCACTGG AGATCAACTT CGACTTCAAC GTCAATTCGC
CAAAGTACCA TGGCAAGTCG ATAGATTTCC TATCCAGTCA AGGCCATGAT CTCACGCAGC ACAGCAAAAG AGGCGTCGCG
CCGGAGTTTG TTTACGAGGG GCTCCTGCGC CACCTCCCGT TCGGCGACGG CTCCGTCACC TGGGTCGCCT TTCACGGCGA
CTATGACTTG GCTTTCCTCC TCCGCTTGCT GCAAGGGGGA GACCATGGCG GCAATTGCCT CCTGCCGCCT AAGCTTGCCA
CCTTCCTGCA AAAAGTGCGG GAGAAGTTCC CAGTCGTCTA CGACGTGCGC GTCCTTGGGA AGCTGGTGAA GGATGGCTTC
AATGGGAGCC TCACCGCACT AGCTGAATAC CTTGGAATTC CGCGTAACGG CGACGAACAC CACGCCGGCT CCGACGCGCT
GCTTACATTG TCCTGTTTCT TCAAGATCGT CAGCCTTTCA GGTCACCAGA TGCACCGCAT GGATGCTCGG CGGGGATTGC
TTGCTGGGTT GGAGGAGTGG AACATGGCTA TCAAATGTGC ACGCCATATT GACAACCATA CTGGAAGCAT CTACGTTGTC
AAGATGCTAC CACATAAGTT GGATGAAGAG GCAAGACGAA TTGAAGAGCT GGTGGCCAGC AACTTCAACA TCGTTGGAGT
AGAGGTAATC CATGCTCAAT TGGGTAAGCG CTCCTACGCA GTTGAAGCCC AACAAAATTA TGAACTCATC AAGACATTTC
TTAAGGATTC TGACTTGTAC GAAATCATCG TCACATTTAT GAACGCTGAA GGAATGTTGG CTTACAGTCG TGCCTGGAAA
TTCTGCATCA GTTCCAGGGC AGACAATGCC TGTGTGCATC CTCAACAGTT TGCTAAGTTT ATGGCATCTT GTGGGGCATT
GGGTGACCCC AACATATCTT GGGTGACATT TCACGGAGCA CATGGGATCG CCAGGATGAT CAGGTCATTC CTTTCTCCCC
AAGACCTTCC AAGCCAATGG TGTTCTTACA TTGGACACCG GAGAGCATTC TTTCCTGCTA TATACGATGT TGCATTGCTT
GTGCGTAGAT CCTTTGACAT CATCACAATT CCTTGGATTG AGTGCAAAGG AGGACTGCTC GATGTTGCTC AAGCACTGAA
CCTGAAGGAA ATTGAGGCTG ACATGGAGGC AGCCAGGGTT CTTCTTACTC TGAGATGCTA TATGAGACTG GCAGAACGCC
CTGATTTCCC AGGCACAAAG ATGGCTGTCC AAGGGCTGCT TAAGGAGAGT TGCTGTTGGA AATGCCCAGC AAATTGCTGA
TGGATGGAGG ATGCATGATC ACTCGGTGTG GTAA

Locus: Os10g0421700

Loading...

Locus: Os10g0421700

Loading...