Os10t0429300-00

Locus

Os10g0429300

Description

Kelch related domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMB30, MB30

Oryzabase Gene Name Synonym(s)

MATH-BTB protein 30, MDC protein with a BTB domain 30, MDC protein having BTB domain 30

Transcript Evidence

tplb0003h03 (Wheat FLcDNA)

Protein Evidence

Q7XEA7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

BTB/POZ-like (IPR000210)

MATH (IPR002083)

TRAF-like (IPR008974)

BTB/POZ fold (IPR011333)

BTB/POZ (IPR013069)

TRAF-type (IPR013322)

Expression Databases

TENOR (Os10t0429300-00)

Others

Oryzabase (21224)

KEGG (Os10t0429300-00)

Transcript

1115 bp

>Os10t0429300-00 Kelch related domain containing protein.
CCATGTCTTTCGCCGGCGTGTCTCTCGTCCGCGACGGGAGGCTGCAGTCGCCTTCGTCGt
cagccatcacctccggcgccaccagcgggtactacctcctcgtggtcgaaggctactcgc
gaaccaaggacaccgtccccaatggcgacttcatcaggtctcgtcctttcagggttggag
gctatcgctgggttatcgactactaccccaatggcgaaagttcggatgatgccgattcca
tctcagtttctcttcagcttgatcaggatagtgaacggcctttcatggcgcattacgagt
ttagtttcatcgacgaaactgagagacaaaagtcgacacatatttgttcggaagcattat
tcgacttctctgatgacaatcgttggggctacaccaatttcattagaagggaggagctag
aaaaatccaagcatctcaaggatgattgtttcaccatcaggtgtgacatcatcctgaaga
aggacggcagcaacaccaccggcgacgacgtggcggcgccgctcgtcgcggtgccaccgt
ccgacatgcaccggcagttcaccgatctgctcctgaccaaggtcggcgccgatgtgacgt
tccaggtcggcggcgagacgttcgccgcgcaccggtgcgtgctcgcggcgcggtccaccg
tcttcatggtggagctctttggccccatgaaggagggcgcaacgacagcaagcgtacata
tcagcgaaatggtgcccgaagcattcaaggccatgcttgcattcatctacaacgacaccc
cgccgccggagacggaggaagacgaagacggcaaggtcgccatgtggcagcacctgctcg
tcgcggcggacaggtacgatctcccgaggctgaagctgatatgcgaggagaagctgtgcg
gccacatcggcgtcggcacggcgaccaccatcctcttgctggccgacaagcaccattgcc
gcgggctgaaggaggcgtgcctggagttcctcagctctcctgcgaacctggaagAAGTAA
TGGAGCATGGCGGATTGGAGGACGTCGTGGGAACATGCCCGTCAGTTCTCGTGGAGCTCA
TTGCGAAGCTTGCTCTGCTCAGGACTCAGGTTTGA

CDS

1113 bp

>Os10t0429300-00 Kelch related domain containing protein.
ATGTCTTTCGCCGGCGTGTCTCTCGTCCGCGACGGGAGGCTGCAGTCGCCTTCGTCGtca
gccatcacctccggcgccaccagcgggtactacctcctcgtggtcgaaggctactcgcga
accaaggacaccgtccccaatggcgacttcatcaggtctcgtcctttcagggttggaggc
tatcgctgggttatcgactactaccccaatggcgaaagttcggatgatgccgattccatc
tcagtttctcttcagcttgatcaggatagtgaacggcctttcatggcgcattacgagttt
agtttcatcgacgaaactgagagacaaaagtcgacacatatttgttcggaagcattattc
gacttctctgatgacaatcgttggggctacaccaatttcattagaagggaggagctagaa
aaatccaagcatctcaaggatgattgtttcaccatcaggtgtgacatcatcctgaagaag
gacggcagcaacaccaccggcgacgacgtggcggcgccgctcgtcgcggtgccaccgtcc
gacatgcaccggcagttcaccgatctgctcctgaccaaggtcggcgccgatgtgacgttc
caggtcggcggcgagacgttcgccgcgcaccggtgcgtgctcgcggcgcggtccaccgtc
ttcatggtggagctctttggccccatgaaggagggcgcaacgacagcaagcgtacatatc
agcgaaatggtgcccgaagcattcaaggccatgcttgcattcatctacaacgacaccccg
ccgccggagacggaggaagacgaagacggcaaggtcgccatgtggcagcacctgctcgtc
gcggcggacaggtacgatctcccgaggctgaagctgatatgcgaggagaagctgtgcggc
cacatcggcgtcggcacggcgaccaccatcctcttgctggccgacaagcaccattgccgc
gggctgaaggaggcgtgcctggagttcctcagctctcctgcgaacctggaagAAGTAATG
GAGCATGGCGGATTGGAGGACGTCGTGGGAACATGCCCGTCAGTTCTCGTGGAGCTCATT
GCGAAGCTTGCTCTGCTCAGGACTCAGGTTTGA

Protein

371 aa

>Os10t0429300-00 Kelch related domain containing protein.
MSFAGVSLVRDGRLQSPSSSAITSGATSGYYLLVVEGYSRTKDTVPNGDFIRSRPFRVGG
YRWVIDYYPNGESSDDADSISVSLQLDQDSERPFMAHYEFSFIDETERQKSTHICSEALF
DFSDDNRWGYTNFIRREELEKSKHLKDDCFTIRCDIILKKDGSNTTGDDVAAPLVAVPPS
DMHRQFTDLLLTKVGADVTFQVGGETFAAHRCVLAARSTVFMVELFGPMKEGATTASVHI
SEMVPEAFKAMLAFIYNDTPPPETEEDEDGKVAMWQHLLVAADRYDLPRLKLICEEKLCG
HIGVGTATTILLLADKHHCRGLKEACLEFLSSPANLEEVMEHGGLEDVVGTCPSVLVELI
AKLALLRTQV*

5'UTR

chr10:15268589..15268590 (+ strand) : 2 bp

CDS

chr10:15268591..15269703 (+ strand) : 1113 bp

FASTA

>Os10t0429300-00 class=Sequence position=chr10:15268589..15269703 (+ strand)
CCATGTCTTT CGCCGGCGTG TCTCTCGTCC GCGACGGGAG GCTGCAGTCG CCTTCGTCGt cagccatcac ctccggcgcc
accagcgggt actacctcct cgtggtcgaa ggctactcgc gaaccaagga caccgtcccc aatggcgact tcatcaggtc
tcgtcctttc agggttggag gctatcgctg ggttatcgac tactacccca atggcgaaag ttcggatgat gccgattcca
tctcagtttc tcttcagctt gatcaggata gtgaacggcc tttcatggcg cattacgagt ttagtttcat cgacgaaact
gagagacaaa agtcgacaca tatttgttcg gaagcattat tcgacttctc tgatgacaat cgttggggct acaccaattt
cattagaagg gaggagctag aaaaatccaa gcatctcaag gatgattgtt tcaccatcag gtgtgacatc atcctgaaga
aggacggcag caacaccacc ggcgacgacg tggcggcgcc gctcgtcgcg gtgccaccgt ccgacatgca ccggcagttc
accgatctgc tcctgaccaa ggtcggcgcc gatgtgacgt tccaggtcgg cggcgagacg ttcgccgcgc accggtgcgt
gctcgcggcg cggtccaccg tcttcatggt ggagctcttt ggccccatga aggagggcgc aacgacagca agcgtacata
tcagcgaaat ggtgcccgaa gcattcaagg ccatgcttgc attcatctac aacgacaccc cgccgccgga gacggaggaa
gacgaagacg gcaaggtcgc catgtggcag cacctgctcg tcgcggcgga caggtacgat ctcccgaggc tgaagctgat
atgcgaggag aagctgtgcg gccacatcgg cgtcggcacg gcgaccacca tcctcttgct ggccgacaag caccattgcc
gcgggctgaa ggaggcgtgc ctggagttcc tcagctctcc tgcgaacctg gaagAAGTAA TGGAGCATGG CGGATTGGAG
GACGTCGTGG GAACATGCCC GTCAGTTCTC GTGGAGCTCA TTGCGAAGCT TGCTCTGCTC AGGACTCAGG TTTGA

Locus: Os10g0429300

Loading...

Locus: Os10g0429300

Loading...