Os10t0430200-01

Locus

Os10g0430200

Description

Similar to Sinapyl alcohol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD3

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 3

Oryzabase Gene Symbol Synonym(s)

OsCAD3

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 3

Transcript Evidence

AK069040 (DDBJ, Best hit)

Protein Evidence

Q8S411 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023003B20 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0430200-01)

RiceXPro (AK069040)

Others

Oryzabase (10432)

KEGG (Os10t0430200-01)

Transcript

1564 bp

>Os10t0430200-01 Similar to Sinapyl alcohol dehydrogenase.
GTGGACGTTTACGCGTGTGTTGTGTGCGCCAGTGAGGACGGCCACGCACGACGCCTCTTC
TCCTCTCGCCGTCTCGCGCAATCGCGCGGCCACAAATAACGCCGCTCCACCTTTTCGCTC
CCGGCTCCTCCTCCTCCTCTCATCCTCTCCTCTCCCACTCCACACCCAGGCACCCAGCTC
GAGCGCGACTCGGCAAATCCATGGCTCCCACGGCGGCGTCGGCGGCGGCGGGGGAGGAGC
AGCAGGCGGTGGGGCTGGCGGCGCGCGACTCCTCCGGCCACCTCTCCCCTTTCGCCATCT
CCCGGAGGAGCACTGGAGATGACGATGTGGCGATAAAGATTCTGTTCTGTGGAATCTGCC
ACTCTGACCTGCACTGCATCAAGAATGAGTGGAAGCACTCCATCTACCCACTTGTTCCTG
GGCACGAGATCGCCGGTGTGGTGACGGAGGTGGGGAAGAACGTCACCAGGTTCAAGGCCG
GCGACAGGGTCGGCGTGGGGTGCATGGTGAACTCGTGCCGGTCATGCGAGAGCTGTAACA
ATGGCTTCGAGAACCACTGCCCGGAGGGCGTCTTCACCTACAACTCCGTCGACAAGGACG
GCACCGTCACCTACGGCGGTTACTCGAGCATGGTGGTGGTGCACGAGCGCTTCGTGGTCA
TGTTCCCGGAGGCGATGCCGCTCGACGTCGGCGCCCCGCTGCTGTGCGCCGGCATCACCG
TGTACACCCCCATGAAGTACCACGGCCTGAACGCGCCGGGGAAGCACGTCGGCGTGCTCG
GCCTGGGCGGGCTCGGCCACGTCGCGGTGAAGTTCGCCAGGGCGTTCGGGTTGAAGGTGA
CGGTGATCAGCTCGTCGCCGGGGAAGAAGCGGGAGGCGCTGGAGCGGCTCGGCGCCGACG
CGTTCGTCGTGAGCAGCAGCGCCGAGGAGATGGAGGCCGCGAGGTCCACCATGGACGGCG
TCATCAACACGGTCTCCGCCAACACCCCCATGGCGCCGTACCTGGCGTTGCTGAAGCCCA
ACGGGAAGATGATCCTCGTCGGCCTCCCGGAGAATCCCCTGGAGGTCCCTCCCTTCTCTC
TCGTCCACGGGAACAGGACTCTGGCAGGGAGCAACATCGGCGGCATGGCGGACACGCAGG
AGATGATCGAGCTGGCGGCGAAGCACGGCGTGACGGCGGACATCGAGGTGATCGGCGCCG
ACGACGTGAACACGGCCATGGAGCGCCTCGCCAAGGCGGATGTCAGGTATCGCTTCGTCA
TCGACGTCGGGAACACCCTCCACGCCGCCGCCGCCGAGTGATGGCATCGCCTGCAAACTA
TTCGTGTGGTCTGTAATCTGTATGAAATTGTTCATGGTACGTACACGATATATAGATTGT
GGCGTGTCATGGCGTATAGGAATGAACCCGATCGAGGAAGCTATTGTTGGTAGTCTGATG
CTAGTCAGCTCAGTGTTTGACTGTTTGCATTTACGGATTGAAATTGAGCTTTGTGTGGCC
TAAGTTTTATTTTCTAAAGATTTCAAGTGAATTTCGTTTTATTCGAATGAAATTCCAGAT
CTTT

CDS

1101 bp

>Os10t0430200-01 Similar to Sinapyl alcohol dehydrogenase.
ATGGCTCCCACGGCGGCGTCGGCGGCGGCGGGGGAGGAGCAGCAGGCGGTGGGGCTGGCG
GCGCGCGACTCCTCCGGCCACCTCTCCCCTTTCGCCATCTCCCGGAGGAGCACTGGAGAT
GACGATGTGGCGATAAAGATTCTGTTCTGTGGAATCTGCCACTCTGACCTGCACTGCATC
AAGAATGAGTGGAAGCACTCCATCTACCCACTTGTTCCTGGGCACGAGATCGCCGGTGTG
GTGACGGAGGTGGGGAAGAACGTCACCAGGTTCAAGGCCGGCGACAGGGTCGGCGTGGGG
TGCATGGTGAACTCGTGCCGGTCATGCGAGAGCTGTAACAATGGCTTCGAGAACCACTGC
CCGGAGGGCGTCTTCACCTACAACTCCGTCGACAAGGACGGCACCGTCACCTACGGCGGT
TACTCGAGCATGGTGGTGGTGCACGAGCGCTTCGTGGTCATGTTCCCGGAGGCGATGCCG
CTCGACGTCGGCGCCCCGCTGCTGTGCGCCGGCATCACCGTGTACACCCCCATGAAGTAC
CACGGCCTGAACGCGCCGGGGAAGCACGTCGGCGTGCTCGGCCTGGGCGGGCTCGGCCAC
GTCGCGGTGAAGTTCGCCAGGGCGTTCGGGTTGAAGGTGACGGTGATCAGCTCGTCGCCG
GGGAAGAAGCGGGAGGCGCTGGAGCGGCTCGGCGCCGACGCGTTCGTCGTGAGCAGCAGC
GCCGAGGAGATGGAGGCCGCGAGGTCCACCATGGACGGCGTCATCAACACGGTCTCCGCC
AACACCCCCATGGCGCCGTACCTGGCGTTGCTGAAGCCCAACGGGAAGATGATCCTCGTC
GGCCTCCCGGAGAATCCCCTGGAGGTCCCTCCCTTCTCTCTCGTCCACGGGAACAGGACT
CTGGCAGGGAGCAACATCGGCGGCATGGCGGACACGCAGGAGATGATCGAGCTGGCGGCG
AAGCACGGCGTGACGGCGGACATCGAGGTGATCGGCGCCGACGACGTGAACACGGCCATG
GAGCGCCTCGCCAAGGCGGATGTCAGGTATCGCTTCGTCATCGACGTCGGGAACACCCTC
CACGCCGCCGCCGCCGAGTGA

Protein

367 aa

>Os10t0430200-01 Similar to Sinapyl alcohol dehydrogenase.
MAPTAASAAAGEEQQAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCI
KNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHC
PEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKY
HGLNAPGKHVGVLGLGGLGHVAVKFARAFGLKVTVISSSPGKKREALERLGADAFVVSSS
AEEMEAARSTMDGVINTVSANTPMAPYLALLKPNGKMILVGLPENPLEVPPFSLVHGNRT
LAGSNIGGMADTQEMIELAAKHGVTADIEVIGADDVNTAMERLAKADVRYRFVIDVGNTL
HAAAAE*

5'UTR

chr10:15309103..15309302 (- strand) : 200 bp

CDS

chr10:15308996..15309102 (- strand) : 107 bp

chr10:15305402..15305515 (- strand) : 114 bp

chr10:15304460..15305127 (- strand) : 668 bp

chr10:15304164..15304375 (- strand) : 212 bp

3'UTR

chr10:15303901..15304163 (- strand) : 263 bp

FASTA

>Os10t0430200-01 class=Sequence position=chr10:15303901..15309302 (- strand)
GTGGACGTTT ACGCGTGTGT TGTGTGCGCC AGTGAGGACG GCCACGCACG ACGCCTCTTC TCCTCTCGCC GTCTCGCGCA
ATCGCGCGGC CACAAATAAC GCCGCTCCAC CTTTTCGCTC CCGGCTCCTC CTCCTCCTCT CATCCTCTCC TCTCCCACTC
CACACCCAGG CACCCAGCTC GAGCGCGACT CGGCAAATCC ATGGCTCCCA CGGCGGCGTC GGCGGCGGCG GGGGAGGAGC
AGCAGGCGGT GGGGCTGGCG GCGCGCGACT CCTCCGGCCA CCTCTCCCCT TTCGCCATCT CCCGGAGGTA CATATGCAAC
CATATACGTC ACCATCGACG CCCTACCTAC CTAGCTAGCT GTCGTCGCAT GCGTGCGCCG GCCTCGTCGC CGCCGCTGCC
GTGGTGGGAC GACGGTCGTC GGCGTACGGA CGGCGGTGGT CTCCGGCCAC TTGGGGCGCT CTGTCCGTAC GTACGTACGG
TGGTGTGCTT TCTCATGTTT CTGCCGAATA GTATATATAT AGTGTTTATT TGTTCCCATG GACTTGACGT CTAGATAACG
ATATTTTggc cgtgtttaga tccaaaaact ttttctttaa agctttcaac cttttcatca catcaaaact ttcctacata
tataaacttt taacttttct attacatcgt tctaatttca accaaacttt taattttgat gtgaactaGG ATACGGTTTA
TCAAAAGTAT TGCTGGAACT GGAACCTAGA gcctcatcgt ttggcatatt catatgctta tcagccaaaa tttgaatttt
caacgttaaa tttggagctg attttgggtt ttttcgtcga agtttatttt tcggccttta cttttagatt ggtaagaaca
catatataaa agttttattt acaaattgat tttcgtttgt aaatatACCT CCGAAAATAT GCCAAACGGT GAAGCTGCTA
GTTTCTCGTG CAAATTTCAT ATGAATTTCG CTGGTAACTA CTGTGACACT TTAATTTGCA AATTCCTCTA AGTTCACCTG
TGAGTTGATT AATAATTAAT TGGGTGCTCA TTTTGGAATC TATtactccc tctgtcccaa aatataaggg attttggaga
gacgtgacat attctattac tactaatctg gacagactat atgtctaaat tcgtaatatt aggatatgtc acatccctta
tattatgggt agttccctaa aagttttttt tttttgaaaa acatcacatc gaacccttga agacatgcat ggagcattaa
atgtagatga aaaaaactaa ttgcacaatt atgatggaaa tcgcgagacg aatcttttga acctaattag ttcatgatta
gccataagtg ctacagtaac ccacatgtgc taatggtgga ttaattaggc tcaagagatt tttgtttcgc ggtttccagc
cgagttatta aattaatttt ttcattcatg ttcgaaaacc ccttccgaca tctggtcaaa catctgatat gatacctaaa
aatttttatt tcaccaacta aacaGGCTCT ATGGGACGGA GGGCTAGCTA GTTTCATTAA TTGCTTGCAT CTATTCTGCT
CTGTTTCCTT CTATTACAAA GAATATTTGA ATAATAAAAT GATATGTTTA GGTGAATATA AGTAGTCAAG TAGTAGTACT
GTTGATTGCT GCTGCCTTCA ATTATGTGTT CCTGTCTGGG CAAATCTCAA CTGCAGATAA CTGTTCCATG TAGCGCAGGC
AATTGCAGGA Atttgcatgc tctatatata aaaggaaaaa gtacgaatta ccccccgaac tatcgcggtc gtccgaatta
ccccctaaac tataaaaccg gacattcttc atccccaact atgcaaacta gacgaattac ccccctcgaa ttaatttaga
gcggttttgt tcaacgtggc gcacacgtgg caatccagtc agcggttttt aattaaaaaa ttgtgggacc cgcatgccat
actcttctct tcttcctctc tctctataga gctctctcgc tttttctgtc tcgtggctcg tggggacggc gaggatggcg
acggcggagg cagcggcggc ggcggcgagg cgaggcggcg gcggaggcag caatcgcggg gaggcgagtg acggtgcagg
gcggcggcag aggcgagcgg cggcgggagc tcgcactgct cgcggaggag gcgaggcggc ggcggcggcg gcggaagagg
cgagcggcgg cggggtgcag cggaggaggc agcggcggcg gcgaggcgag gcggtcggcg agcccggtcg agcagcgccc
cctccacggc gaacccaccg gcggtgacac cgaccgccac gcctataccc tcccccatct ttcgacggct gaccgccacg
cctctcccct accaaatcaa tatcacctgg cgccagacgc atcataatgc agccatgccc gccacatcaa ctcccctggg
atagatcgtc cagcagcggc atcaccacag ctctgccgcc accgctccgt ccgccgtcgc cgtcctcgcc gtccccgcga
gccacgagag agagagaata gagagagagg aagaagagaa gagtatggca tgcgggtcct acaatttttt aattaaaaaa
acgctgactg gattgccacg tgtgcgccac gttggacaaa actgctctga attggttcga gggggataat tcgtccggtt
tgcatagttg ggggtggaga atgtccggtt ttgtgtttta agggggtaat tcggacgacc gcgatagttc ggggggtaat
tcgtactttt ttcctatata aaatatacAA TCATTTATGT GGGCCTTCTC ATCTTTGTTT AGCCTTTTCA AGTACCTATT
GTGACTTGTG TGGTCAAAAT CTTTTTCTAA ATTTATGTGG GAAAAGAACT GAATCCTGTA ATGCAAATAT GCACGTGTTC
CGACTTGTGA GTTCTTGCTG GTGGATTAGC ATGTTTTGGC CGTCTCTTGT TACTTCTGCT TGCCAAAGCG TTTACGGAAG
CATCAAGGTG TTTATAAGAA TTACTATTTA CAAAATTACA AGGTTTTACA TTTCGATGAC AAAAGTTACA TCCACCGAAA
TTTTTAAGTT TCCAATGTTT TGATAAATTA TTTTTGAACT TCTTAACAAA ATTTGATCAG CTACGAGGCC AGCACATACT
ACTAGCTAGC GTTGTGCATC TCAATTTTGG AAATTTCAAA CCTTAATTCG CTATTTTGGT TGGGCATGCA TGTTTGTCCT
GTGTCGTCGA ACTGTGCAGC CATGTTTTTC TTTTGGGATT TTGTGAGCTA AAATCCATTC TGGTTCTTTT CATCAATTGG
CTGGCTAGTG GCTCACTTTT CTGGCAGCTG GTCGGTTGCA GTACATTCAC AACCTTGAAA TTTTGTGATA GCTACTTGGC
TGCACTGCAT ATGGTGGTTG ATGAGTCCAT ACTTTTCTGG TCCTGAATAA TTTGTCTTTT CCAAACGGGT AGTTTGAATT
TGCTTTAGTT ACTGGTTATG GTTGTAATTT GCTGAATCTC TTTTTGCGGT CATATTTACT AGTATGGCTG TATCGATGGA
CAGCTTTGGA CGATCTGCAT GAACGAAATT CATAAGTCAA CAGAACAGGG TTAAGTCAAC TAATTTGTTT GGTTTCAGTT
TGGGGTGTAT ACTTTGCATA TAGGATCATC TGAATCAAAA TCTTTCTTCT GGCTGCATTA CAATTATGCA TTGTAGTAGT
TTCTGATAAT TACTTGCAAT TCTGCAGGAG CACTGGAGAT GACGATGTGG CGATAAAGAT TCTGTTCTGT GGAATCTGCC
ACTCTGACCT GCACTGCATC AAGAATGAGT GGAAGCACTC CATCTACCCA CTTGTTCCTG GGTAATGGAA TTTCCGAAAC
CCCGCACCGG CACGCTCAAA TCTCGTCCGA AATTTTCTGT TTtttacatt ttttttgtga atttggtcta attttattta
aattcagtca aattttCAAA TAATTTCGTC TCGAAATTTC TAAAATTTTG GCAACCCCCG GCATAAAATC CAATTTCAAA
ATTGAAAACC CTGATCAAGC CTATATCCAT GGCTATCTGC TTCTGAAAAT TTTAAACAAA CACAAGCTTG AACCTCCCGA
TCGACGCGTA TGCAGGCACG AGATCGCCGG TGTGGTGACG GAGGTGGGGA AGAACGTCAC CAGGTTCAAG GCCGGCGACA
GGGTCGGCGT GGGGTGCATG GTGAACTCGT GCCGGTCATG CGAGAGCTGT AACAATGGCT TCGAGAACCA CTGCCCGGAG
GGCGTCTTCA CCTACAACTC CGTCGACAAG GACGGCACCG TCACCTACGG CGGTTACTCG AGCATGGTGG TGGTGCACGA
GCGCTTCGTG GTCATGTTCC CGGAGGCGAT GCCGCTCGAC GTCGGCGCCC CGCTGCTGTG CGCCGGCATC ACCGTGTACA
CCCCCATGAA GTACCACGGC CTGAACGCGC CGGGGAAGCA CGTCGGCGTG CTCGGCCTGG GCGGGCTCGG CCACGTCGCG
GTGAAGTTCG CCAGGGCGTT CGGGTTGAAG GTGACGGTGA TCAGCTCGTC GCCGGGGAAG AAGCGGGAGG CGCTGGAGCG
GCTCGGCGCC GACGCGTTCG TCGTGAGCAG CAGCGCCGAG GAGATGGAGG CCGCGAGGTC CACCATGGAC GGCGTCATCA
ACACGGTCTC CGCCAACACC CCCATGGCGC CGTACCTGGC GTTGCTGAAG CCCAACGGGA AGATGATCCT CGTCGGCCTC
CCGGAGAATC CCCTGGAGGT CCCTCCCTTC TCTCTCGTCC ACGGTAAGCA AGCTCCATCG TCGAGATCGA GCTCGATCGC
CACCGCCACG GCTAGCTGCA CCTTGATGAT TTATGATGAT GATGCAGGGA ACAGGACTCT GGCAGGGAGC AACATCGGCG
GCATGGCGGA CACGCAGGAG ATGATCGAGC TGGCGGCGAA GCACGGCGTG ACGGCGGACA TCGAGGTGAT CGGCGCCGAC
GACGTGAACA CGGCCATGGA GCGCCTCGCC AAGGCGGATG TCAGGTATCG CTTCGTCATC GACGTCGGGA ACACCCTCCA
CGCCGCCGCC GCCGAGTGAT GGCATCGCCT GCAAACTATT CGTGTGGTCT GTAATCTGTA TGAAATTGTT CATGGTACGT
ACACGATATA TAGATTGTGG CGTGTCATGG CGTATAGGAA TGAACCCGAT CGAGGAAGCT ATTGTTGGTA GTCTGATGCT
AGTCAGCTCA GTGTTTGACT GTTTGCATTT ACGGATTGAA ATTGAGCTTT GTGTGGCCTA AGTTTTATTT TCTAAAGATT
TCAAGTGAAT TTCGTTTTAT TCGAATGAAA TTCCAGATCT TT

Locus: Os10g0430200

Loading...

Locus: Os10g0430200

Loading...