Os10t0430200-02

Locus

Os10g0430200

Description

Similar to Sinapyl alcohol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD3

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 3

Oryzabase Gene Symbol Synonym(s)

OsCAD3

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 3

Transcript Evidence

AK104047 (DDBJ, Best hit)

Protein Evidence

Q8S411 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

001-022-H02 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0430200-02)

RiceXPro (AK104047)

Others

Oryzabase (10432)

KEGG (Os10t0430200-02)

Transcript

1410 bp

>Os10t0430200-02 Similar to Sinapyl alcohol dehydrogenase.
ACAAATAACGCCGCTCCACCTTTTCGCTCCCGGCTCCTCCTCCTCCTCTCATCCTCTCCT
CTCCCACTCCACACCCAGGCACCCAGCTCGAGCGCGACTCGGCAAATCCATGGCTCCCAC
GGCGGCGTCGGCGGCGGCGGGGGAGGAGCAGCAGGCGGTGGGGCTGGCGGCGCGCGACTC
CTCCGGCCACCTCTCCCCTTTCGCCATCTCCCGGAGGAGCACTGGAGATGACGATGTGGC
GATAAAGATTCTGTTCTGTGGAATCTGCCACTCTGACCTGCACTGCATCAAGAATGAGTG
GAAGCACTCCATCTACCCACTTGTTCCTGGGCACGAGATCGCCGGTGTGGTGACGGAGGT
GGGGAAGAACGTCACCAGGTTCAAGGCCGGCGACAGGGTCGGCGTGGGGTGCATGGTGAA
CTCGTGCCGGTCATGCGAGAGCTGTAACAATGGCTTCGAGAACCACTGCCCGGAGGGCGT
CTTCACCTACAACTCCGTCGACAAGGACGGCACCGTCACCTACGGCGGTTACTCGAGCAT
GGTGGTGGTGCACGAGCGCTTCGTGGTCATGTTCCCGGAGGCGATGCCGCTCGACGTCGG
CGCCCCGCTGCTGTGCGCCGGCATCACCGTGTACACCCCCATGAAGTACCACGGCCTGAA
CGCGCCGGGGAAGCACGTCGGCGTGCTCGGCCTGGGCGGGCTCGGCCACGTCGCGGTGAA
GTTCGCCAGGGCGTTCGGGTTGAAGGTGACGGTGATCAGCTCGTCGCCGGGGAAGAAGCG
GGAGGCGCTGGAGCGGCTCGGCGCCGACGCGTTCGTCGTGAGCAGCAGCGCCGAGGAGAT
GGAGGCCGCGAGGTCCACCATGGACGGCGTCATCAACACGGTCTCCGCCAACACCCCCAT
GGCGCCGTACCTGGCGTTGCTGAAGCCCAACGGGAAGATGATCCTCGTCGGCCTCCCGGA
GAATCCCCTGGAGGTCCCTCCCTTCTCTCTCGTCCACGGGAACAGGACTCTGGCAGGGAG
CAACATCGGCGGCATGGCGGACACGCAGGAGATGATCGAGCTGGCGGCGAAGCACGGCGT
GACGGCGGACATCGAGGTGATCGGCGCCGACGACGTGAACACGGCCATGGAGCGCCTCGC
CAAGGCGGATGTCAGGTATCGCTTCGTCATCGACGTCGGGAACACCCTCCACGCCGCCGC
CGCCGAGTGATGGCATCGCCTGCAAACTATTCGTGTGGTCTGTAATCTGTATGAAATTGT
TCATGGTACGTACACGATATATAGATTGTGGCGTGTCATGGCGTATAGGAATGAACCCGA
TCGAGGAAGCTATTGTTGGTAGTCTGATGCTAGTCAGCTCAGTGTTTGACTGTTTGCATT
TACGGATTGAAATTGAGCTTTGTGTGGCCT

CDS

1101 bp

>Os10t0430200-02 Similar to Sinapyl alcohol dehydrogenase.
ATGGCTCCCACGGCGGCGTCGGCGGCGGCGGGGGAGGAGCAGCAGGCGGTGGGGCTGGCG
GCGCGCGACTCCTCCGGCCACCTCTCCCCTTTCGCCATCTCCCGGAGGAGCACTGGAGAT
GACGATGTGGCGATAAAGATTCTGTTCTGTGGAATCTGCCACTCTGACCTGCACTGCATC
AAGAATGAGTGGAAGCACTCCATCTACCCACTTGTTCCTGGGCACGAGATCGCCGGTGTG
GTGACGGAGGTGGGGAAGAACGTCACCAGGTTCAAGGCCGGCGACAGGGTCGGCGTGGGG
TGCATGGTGAACTCGTGCCGGTCATGCGAGAGCTGTAACAATGGCTTCGAGAACCACTGC
CCGGAGGGCGTCTTCACCTACAACTCCGTCGACAAGGACGGCACCGTCACCTACGGCGGT
TACTCGAGCATGGTGGTGGTGCACGAGCGCTTCGTGGTCATGTTCCCGGAGGCGATGCCG
CTCGACGTCGGCGCCCCGCTGCTGTGCGCCGGCATCACCGTGTACACCCCCATGAAGTAC
CACGGCCTGAACGCGCCGGGGAAGCACGTCGGCGTGCTCGGCCTGGGCGGGCTCGGCCAC
GTCGCGGTGAAGTTCGCCAGGGCGTTCGGGTTGAAGGTGACGGTGATCAGCTCGTCGCCG
GGGAAGAAGCGGGAGGCGCTGGAGCGGCTCGGCGCCGACGCGTTCGTCGTGAGCAGCAGC
GCCGAGGAGATGGAGGCCGCGAGGTCCACCATGGACGGCGTCATCAACACGGTCTCCGCC
AACACCCCCATGGCGCCGTACCTGGCGTTGCTGAAGCCCAACGGGAAGATGATCCTCGTC
GGCCTCCCGGAGAATCCCCTGGAGGTCCCTCCCTTCTCTCTCGTCCACGGGAACAGGACT
CTGGCAGGGAGCAACATCGGCGGCATGGCGGACACGCAGGAGATGATCGAGCTGGCGGCG
AAGCACGGCGTGACGGCGGACATCGAGGTGATCGGCGCCGACGACGTGAACACGGCCATG
GAGCGCCTCGCCAAGGCGGATGTCAGGTATCGCTTCGTCATCGACGTCGGGAACACCCTC
CACGCCGCCGCCGCCGAGTGA

Protein

367 aa

>Os10t0430200-02 Similar to Sinapyl alcohol dehydrogenase.
MAPTAASAAAGEEQQAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCI
KNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHC
PEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKY
HGLNAPGKHVGVLGLGGLGHVAVKFARAFGLKVTVISSSPGKKREALERLGADAFVVSSS
AEEMEAARSTMDGVINTVSANTPMAPYLALLKPNGKMILVGLPENPLEVPPFSLVHGNRT
LAGSNIGGMADTQEMIELAAKHGVTADIEVIGADDVNTAMERLAKADVRYRFVIDVGNTL
HAAAAE*

5'UTR

chr10:15309103..15309211 (- strand) : 109 bp

CDS

chr10:15308996..15309102 (- strand) : 107 bp

chr10:15305402..15305515 (- strand) : 114 bp

chr10:15304460..15305127 (- strand) : 668 bp

chr10:15304164..15304375 (- strand) : 212 bp

3'UTR

chr10:15303964..15304163 (- strand) : 200 bp

FASTA

>Os10t0430200-02 class=Sequence position=chr10:15303964..15309211 (- strand)
ACAAATAACG CCGCTCCACC TTTTCGCTCC CGGCTCCTCC TCCTCCTCTC ATCCTCTCCT CTCCCACTCC ACACCCAGGC
ACCCAGCTCG AGCGCGACTC GGCAAATCCA TGGCTCCCAC GGCGGCGTCG GCGGCGGCGG GGGAGGAGCA GCAGGCGGTG
GGGCTGGCGG CGCGCGACTC CTCCGGCCAC CTCTCCCCTT TCGCCATCTC CCGGAGGTAC ATATGCAACC ATATACGTCA
CCATCGACGC CCTACCTACC TAGCTAGCTG TCGTCGCATG CGTGCGCCGG CCTCGTCGCC GCCGCTGCCG TGGTGGGACG
ACGGTCGTCG GCGTACGGAC GGCGGTGGTC TCCGGCCACT TGGGGCGCTC TGTCCGTACG TACGTACGGT GGTGTGCTTT
CTCATGTTTC TGCCGAATAG TATATATATA GTGTTTATTT GTTCCCATGG ACTTGACGTC TAGATAACGA TATTTTggcc
gtgtttagat ccaaaaactt tttctttaaa gctttcaacc ttttcatcac atcaaaactt tcctacatat ataaactttt
aacttttcta ttacatcgtt ctaatttcaa ccaaactttt aattttgatg tgaactaGGA TACGGTTTAT CAAAAGTATT
GCTGGAACTG GAACCTAGAg cctcatcgtt tggcatattc atatgcttat cagccaaaat ttgaattttc aacgttaaat
ttggagctga ttttgggttt tttcgtcgaa gtttattttt cggcctttac ttttagattg gtaagaacac atatataaaa
gttttattta caaattgatt ttcgtttgta aatatACCTC CGAAAATATG CCAAACGGTG AAGCTGCTAG TTTCTCGTGC
AAATTTCATA TGAATTTCGC TGGTAACTAC TGTGACACTT TAATTTGCAA ATTCCTCTAA GTTCACCTGT GAGTTGATTA
ATAATTAATT GGGTGCTCAT TTTGGAATCT ATtactccct ctgtcccaaa atataaggga ttttggagag acgtgacata
ttctattact actaatctgg acagactata tgtctaaatt cgtaatatta ggatatgtca catcccttat attatgggta
gttccctaaa agtttttttt ttttgaaaaa catcacatcg aacccttgaa gacatgcatg gagcattaaa tgtagatgaa
aaaaactaat tgcacaatta tgatggaaat cgcgagacga atcttttgaa cctaattagt tcatgattag ccataagtgc
tacagtaacc cacatgtgct aatggtggat taattaggct caagagattt ttgtttcgcg gtttccagcc gagttattaa
attaattttt tcattcatgt tcgaaaaccc cttccgacat ctggtcaaac atctgatatg atacctaaaa atttttattt
caccaactaa acaGGCTCTA TGGGACGGAG GGCTAGCTAG TTTCATTAAT TGCTTGCATC TATTCTGCTC TGTTTCCTTC
TATTACAAAG AATATTTGAA TAATAAAATG ATATGTTTAG GTGAATATAA GTAGTCAAGT AGTAGTACTG TTGATTGCTG
CTGCCTTCAA TTATGTGTTC CTGTCTGGGC AAATCTCAAC TGCAGATAAC TGTTCCATGT AGCGCAGGCA ATTGCAGGAA
tttgcatgct ctatatataa aaggaaaaag tacgaattac cccccgaact atcgcggtcg tccgaattac cccctaaact
ataaaaccgg acattcttca tccccaacta tgcaaactag acgaattacc cccctcgaat taatttagag cggttttgtt
caacgtggcg cacacgtggc aatccagtca gcggttttta attaaaaaat tgtgggaccc gcatgccata ctcttctctt
cttcctctct ctctatagag ctctctcgct ttttctgtct cgtggctcgt ggggacggcg aggatggcga cggcggaggc
agcggcggcg gcggcgaggc gaggcggcgg cggaggcagc aatcgcgggg aggcgagtga cggtgcaggg cggcggcaga
ggcgagcggc ggcgggagct cgcactgctc gcggaggagg cgaggcggcg gcggcggcgg cggaagaggc gagcggcggc
ggggtgcagc ggaggaggca gcggcggcgg cgaggcgagg cggtcggcga gcccggtcga gcagcgcccc ctccacggcg
aacccaccgg cggtgacacc gaccgccacg cctataccct cccccatctt tcgacggctg accgccacgc ctctccccta
ccaaatcaat atcacctggc gccagacgca tcataatgca gccatgcccg ccacatcaac tcccctggga tagatcgtcc
agcagcggca tcaccacagc tctgccgcca ccgctccgtc cgccgtcgcc gtcctcgccg tccccgcgag ccacgagaga
gagagaatag agagagagga agaagagaag agtatggcat gcgggtccta caatttttta attaaaaaaa cgctgactgg
attgccacgt gtgcgccacg ttggacaaaa ctgctctgaa ttggttcgag ggggataatt cgtccggttt gcatagttgg
gggtggagaa tgtccggttt tgtgttttaa gggggtaatt cggacgaccg cgatagttcg gggggtaatt cgtacttttt
tcctatataa aatatacAAT CATTTATGTG GGCCTTCTCA TCTTTGTTTA GCCTTTTCAA GTACCTATTG TGACTTGTGT
GGTCAAAATC TTTTTCTAAA TTTATGTGGG AAAAGAACTG AATCCTGTAA TGCAAATATG CACGTGTTCC GACTTGTGAG
TTCTTGCTGG TGGATTAGCA TGTTTTGGCC GTCTCTTGTT ACTTCTGCTT GCCAAAGCGT TTACGGAAGC ATCAAGGTGT
TTATAAGAAT TACTATTTAC AAAATTACAA GGTTTTACAT TTCGATGACA AAAGTTACAT CCACCGAAAT TTTTAAGTTT
CCAATGTTTT GATAAATTAT TTTTGAACTT CTTAACAAAA TTTGATCAGC TACGAGGCCA GCACATACTA CTAGCTAGCG
TTGTGCATCT CAATTTTGGA AATTTCAAAC CTTAATTCGC TATTTTGGTT GGGCATGCAT GTTTGTCCTG TGTCGTCGAA
CTGTGCAGCC ATGTTTTTCT TTTGGGATTT TGTGAGCTAA AATCCATTCT GGTTCTTTTC ATCAATTGGC TGGCTAGTGG
CTCACTTTTC TGGCAGCTGG TCGGTTGCAG TACATTCACA ACCTTGAAAT TTTGTGATAG CTACTTGGCT GCACTGCATA
TGGTGGTTGA TGAGTCCATA CTTTTCTGGT CCTGAATAAT TTGTCTTTTC CAAACGGGTA GTTTGAATTT GCTTTAGTTA
CTGGTTATGG TTGTAATTTG CTGAATCTCT TTTTGCGGTC ATATTTACTA GTATGGCTGT ATCGATGGAC AGCTTTGGAC
GATCTGCATG AACGAAATTC ATAAGTCAAC AGAACAGGGT TAAGTCAACT AATTTGTTTG GTTTCAGTTT GGGGTGTATA
CTTTGCATAT AGGATCATCT GAATCAAAAT CTTTCTTCTG GCTGCATTAC AATTATGCAT TGTAGTAGTT TCTGATAATT
ACTTGCAATT CTGCAGGAGC ACTGGAGATG ACGATGTGGC GATAAAGATT CTGTTCTGTG GAATCTGCCA CTCTGACCTG
CACTGCATCA AGAATGAGTG GAAGCACTCC ATCTACCCAC TTGTTCCTGG GTAATGGAAT TTCCGAAACC CCGCACCGGC
ACGCTCAAAT CTCGTCCGAA ATTTTCTGTT Ttttacattt tttttgtgaa tttggtctaa ttttatttaa attcagtcaa
attttCAAAT AATTTCGTCT CGAAATTTCT AAAATTTTGG CAACCCCCGG CATAAAATCC AATTTCAAAA TTGAAAACCC
TGATCAAGCC TATATCCATG GCTATCTGCT TCTGAAAATT TTAAACAAAC ACAAGCTTGA ACCTCCCGAT CGACGCGTAT
GCAGGCACGA GATCGCCGGT GTGGTGACGG AGGTGGGGAA GAACGTCACC AGGTTCAAGG CCGGCGACAG GGTCGGCGTG
GGGTGCATGG TGAACTCGTG CCGGTCATGC GAGAGCTGTA ACAATGGCTT CGAGAACCAC TGCCCGGAGG GCGTCTTCAC
CTACAACTCC GTCGACAAGG ACGGCACCGT CACCTACGGC GGTTACTCGA GCATGGTGGT GGTGCACGAG CGCTTCGTGG
TCATGTTCCC GGAGGCGATG CCGCTCGACG TCGGCGCCCC GCTGCTGTGC GCCGGCATCA CCGTGTACAC CCCCATGAAG
TACCACGGCC TGAACGCGCC GGGGAAGCAC GTCGGCGTGC TCGGCCTGGG CGGGCTCGGC CACGTCGCGG TGAAGTTCGC
CAGGGCGTTC GGGTTGAAGG TGACGGTGAT CAGCTCGTCG CCGGGGAAGA AGCGGGAGGC GCTGGAGCGG CTCGGCGCCG
ACGCGTTCGT CGTGAGCAGC AGCGCCGAGG AGATGGAGGC CGCGAGGTCC ACCATGGACG GCGTCATCAA CACGGTCTCC
GCCAACACCC CCATGGCGCC GTACCTGGCG TTGCTGAAGC CCAACGGGAA GATGATCCTC GTCGGCCTCC CGGAGAATCC
CCTGGAGGTC CCTCCCTTCT CTCTCGTCCA CGGTAAGCAA GCTCCATCGT CGAGATCGAG CTCGATCGCC ACCGCCACGG
CTAGCTGCAC CTTGATGATT TATGATGATG ATGCAGGGAA CAGGACTCTG GCAGGGAGCA ACATCGGCGG CATGGCGGAC
ACGCAGGAGA TGATCGAGCT GGCGGCGAAG CACGGCGTGA CGGCGGACAT CGAGGTGATC GGCGCCGACG ACGTGAACAC
GGCCATGGAG CGCCTCGCCA AGGCGGATGT CAGGTATCGC TTCGTCATCG ACGTCGGGAA CACCCTCCAC GCCGCCGCCG
CCGAGTGATG GCATCGCCTG CAAACTATTC GTGTGGTCTG TAATCTGTAT GAAATTGTTC ATGGTACGTA CACGATATAT
AGATTGTGGC GTGTCATGGC GTATAGGAAT GAACCCGATC GAGGAAGCTA TTGTTGGTAG TCTGATGCTA GTCAGCTCAG
TGTTTGACTG TTTGCATTTA CGGATTGAAA TTGAGCTTTG TGTGGCCT

Locus: Os10g0430200

Loading...

Locus: Os10g0430200

Loading...