Os10t0430200-03

Locus

Os10g0430200

Description

Similar to Sinapyl alcohol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD3

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 3

Oryzabase Gene Symbol Synonym(s)

OsCAD3

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 3

Transcript Evidence

AK099176 (DDBJ, Best hit)

Protein Evidence

Q8S411 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023090E20 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0430200-03)

Others

Oryzabase (10432)

Transcript

1392 bp

>Os10t0430200-03 Similar to Sinapyl alcohol dehydrogenase.
GGCTCCTCCTCCTCCTCTCATCCTCTCCTCTCCCACTCCACACCCAGGCACCCAGCTCGA
GCGCGACTCGGCAAATCCATGGCTCCCACGGCGGCGTCGGCGGCGGCGGGGGAGGAGCAG
CAGGCGGTGGGGCTGGCGGCGCGCGACTCCTCCGGCCACCTCTCCCCTTTCGCCATCTCC
CGGAGGAGCACTGGAGATGACGATGTGGCGATAAAGATTCTGTTCTGTGGAATCTGCCAC
TCTGACCTGCACTGCATCAAGAATGAGTGGAAGCACTCCATCTACCCACTTGTTCCTGGG
CACGAGATCGCCGGTGTGGTGACGGAGGTGGGGAAGAACGTCACCAGGTTCAAGGCCGGC
GACAGGGTCGGCGTGGGGTGCATGGTGAACTCGTGCCGGTCATGCGAGAGCTGTAACAAT
GGCTTCGAGAACCACTGCCCGGAGGGCGTCTTCACCTACAACTCCGTCGACAAGGACGGC
ACCGTCACCTACGGCGGTTACTCGAGCATGGTGGTGGTGCACGAGCGCTTCGTGGTCATG
TTCCCGGAGGCGATGCCGCTCGACGTCGGCGCCCCGCTGCTGTGCGCCGGCATCACCGTG
TACACCCCCATGAAGTACCACGGCCTGAACGCGCCGGGGAAGCACGTCGGCGTGCTCGGC
CTGGGCGGGCTCGGCCACGTCGCGGTGAAGTTCGCCAGGGCGTTCGGGTTGAAGGTGACG
GTGATCAGCTCGTCGCCGGGGAAGAAGCGGGAGGCGCTGGAGCGGCTCGGCGCCGACGCG
TTCGTCGTGAGCAGCAGCGCCGAGGAGATGGAGGCCGCGAGGTCCACCATGGACGGCGTC
ATCAACACGGTCTCCGCCAACACCCCCATGGCGCCGTACCTGGCGTTGCTGAAGCCCAAC
GGGAAGATGATCCTCGTCGGCCTCCCGGAGAATCCCCTGGAGGTCCCTCCCTTCTCTCTC
GTCCACGGGAACAGGACTCTGGCAGGGAGCAACATCGGCGGCATGGCGGACACGCAGGAG
ATGATCGAGCTGGCGGCGAAGCACGGCGTGACGGCGGACATCGAGGTGATCGGCGCCGAC
GACGTGAACACGGCCATGGAGCGCCTCGCCAAGGCGGATGTCAGGTATCGCTTCGTCATC
GACGTCGGGAACACCCTCCACGCCGCCGCCGCCGAGTGATGGCATCGCCTGCAAACTATT
CGTGTGGTCTGTAATCTGTATGAAATTGTTCATGGTACGTACACGATATATAGATTGTGG
CGTGTCATGGCGTATAGGAATGAACCCGATCGAGGAAGCTATTGTTGGTAGTCTGATGCT
AGTCAGCTCAGTGTTTGACTGTTTGCATTTACGGATTGAAATTGAGCTTTGTGTGGCCTA
AGTTTTATTTTC

CDS

1101 bp

>Os10t0430200-03 Similar to Sinapyl alcohol dehydrogenase.
ATGGCTCCCACGGCGGCGTCGGCGGCGGCGGGGGAGGAGCAGCAGGCGGTGGGGCTGGCG
GCGCGCGACTCCTCCGGCCACCTCTCCCCTTTCGCCATCTCCCGGAGGAGCACTGGAGAT
GACGATGTGGCGATAAAGATTCTGTTCTGTGGAATCTGCCACTCTGACCTGCACTGCATC
AAGAATGAGTGGAAGCACTCCATCTACCCACTTGTTCCTGGGCACGAGATCGCCGGTGTG
GTGACGGAGGTGGGGAAGAACGTCACCAGGTTCAAGGCCGGCGACAGGGTCGGCGTGGGG
TGCATGGTGAACTCGTGCCGGTCATGCGAGAGCTGTAACAATGGCTTCGAGAACCACTGC
CCGGAGGGCGTCTTCACCTACAACTCCGTCGACAAGGACGGCACCGTCACCTACGGCGGT
TACTCGAGCATGGTGGTGGTGCACGAGCGCTTCGTGGTCATGTTCCCGGAGGCGATGCCG
CTCGACGTCGGCGCCCCGCTGCTGTGCGCCGGCATCACCGTGTACACCCCCATGAAGTAC
CACGGCCTGAACGCGCCGGGGAAGCACGTCGGCGTGCTCGGCCTGGGCGGGCTCGGCCAC
GTCGCGGTGAAGTTCGCCAGGGCGTTCGGGTTGAAGGTGACGGTGATCAGCTCGTCGCCG
GGGAAGAAGCGGGAGGCGCTGGAGCGGCTCGGCGCCGACGCGTTCGTCGTGAGCAGCAGC
GCCGAGGAGATGGAGGCCGCGAGGTCCACCATGGACGGCGTCATCAACACGGTCTCCGCC
AACACCCCCATGGCGCCGTACCTGGCGTTGCTGAAGCCCAACGGGAAGATGATCCTCGTC
GGCCTCCCGGAGAATCCCCTGGAGGTCCCTCCCTTCTCTCTCGTCCACGGGAACAGGACT
CTGGCAGGGAGCAACATCGGCGGCATGGCGGACACGCAGGAGATGATCGAGCTGGCGGCG
AAGCACGGCGTGACGGCGGACATCGAGGTGATCGGCGCCGACGACGTGAACACGGCCATG
GAGCGCCTCGCCAAGGCGGATGTCAGGTATCGCTTCGTCATCGACGTCGGGAACACCCTC
CACGCCGCCGCCGCCGAGTGA

Protein

367 aa

>Os10t0430200-03 Similar to Sinapyl alcohol dehydrogenase.
MAPTAASAAAGEEQQAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCI
KNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHC
PEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKY
HGLNAPGKHVGVLGLGGLGHVAVKFARAFGLKVTVISSSPGKKREALERLGADAFVVSSS
AEEMEAARSTMDGVINTVSANTPMAPYLALLKPNGKMILVGLPENPLEVPPFSLVHGNRT
LAGSNIGGMADTQEMIELAAKHGVTADIEVIGADDVNTAMERLAKADVRYRFVIDVGNTL
HAAAAE*

5'UTR

chr10:15309103..15309180 (- strand) : 78 bp

CDS

chr10:15308996..15309102 (- strand) : 107 bp

chr10:15305402..15305515 (- strand) : 114 bp

chr10:15304460..15305127 (- strand) : 668 bp

chr10:15304164..15304375 (- strand) : 212 bp

3'UTR

chr10:15303951..15304163 (- strand) : 213 bp

FASTA

>Os10t0430200-03 class=Sequence position=chr10:15303951..15309180 (- strand)
GGCTCCTCCT CCTCCTCTCA TCCTCTCCTC TCCCACTCCA CACCCAGGCA CCCAGCTCGA GCGCGACTCG GCAAATCCAT
GGCTCCCACG GCGGCGTCGG CGGCGGCGGG GGAGGAGCAG CAGGCGGTGG GGCTGGCGGC GCGCGACTCC TCCGGCCACC
TCTCCCCTTT CGCCATCTCC CGGAGGTACA TATGCAACCA TATACGTCAC CATCGACGCC CTACCTACCT AGCTAGCTGT
CGTCGCATGC GTGCGCCGGC CTCGTCGCCG CCGCTGCCGT GGTGGGACGA CGGTCGTCGG CGTACGGACG GCGGTGGTCT
CCGGCCACTT GGGGCGCTCT GTCCGTACGT ACGTACGGTG GTGTGCTTTC TCATGTTTCT GCCGAATAGT ATATATATAG
TGTTTATTTG TTCCCATGGA CTTGACGTCT AGATAACGAT ATTTTggccg tgtttagatc caaaaacttt ttctttaaag
ctttcaacct tttcatcaca tcaaaacttt cctacatata taaactttta acttttctat tacatcgttc taatttcaac
caaactttta attttgatgt gaactaGGAT ACGGTTTATC AAAAGTATTG CTGGAACTGG AACCTAGAgc ctcatcgttt
ggcatattca tatgcttatc agccaaaatt tgaattttca acgttaaatt tggagctgat tttgggtttt ttcgtcgaag
tttatttttc ggcctttact tttagattgg taagaacaca tatataaaag ttttatttac aaattgattt tcgtttgtaa
atatACCTCC GAAAATATGC CAAACGGTGA AGCTGCTAGT TTCTCGTGCA AATTTCATAT GAATTTCGCT GGTAACTACT
GTGACACTTT AATTTGCAAA TTCCTCTAAG TTCACCTGTG AGTTGATTAA TAATTAATTG GGTGCTCATT TTGGAATCTA
Ttactccctc tgtcccaaaa tataagggat tttggagaga cgtgacatat tctattacta ctaatctgga cagactatat
gtctaaattc gtaatattag gatatgtcac atcccttata ttatgggtag ttccctaaaa gttttttttt tttgaaaaac
atcacatcga acccttgaag acatgcatgg agcattaaat gtagatgaaa aaaactaatt gcacaattat gatggaaatc
gcgagacgaa tcttttgaac ctaattagtt catgattagc cataagtgct acagtaaccc acatgtgcta atggtggatt
aattaggctc aagagatttt tgtttcgcgg tttccagccg agttattaaa ttaatttttt cattcatgtt cgaaaacccc
ttccgacatc tggtcaaaca tctgatatga tacctaaaaa tttttatttc accaactaaa caGGCTCTAT GGGACGGAGG
GCTAGCTAGT TTCATTAATT GCTTGCATCT ATTCTGCTCT GTTTCCTTCT ATTACAAAGA ATATTTGAAT AATAAAATGA
TATGTTTAGG TGAATATAAG TAGTCAAGTA GTAGTACTGT TGATTGCTGC TGCCTTCAAT TATGTGTTCC TGTCTGGGCA
AATCTCAACT GCAGATAACT GTTCCATGTA GCGCAGGCAA TTGCAGGAAt ttgcatgctc tatatataaa aggaaaaagt
acgaattacc ccccgaacta tcgcggtcgt ccgaattacc ccctaaacta taaaaccgga cattcttcat ccccaactat
gcaaactaga cgaattaccc ccctcgaatt aatttagagc ggttttgttc aacgtggcgc acacgtggca atccagtcag
cggtttttaa ttaaaaaatt gtgggacccg catgccatac tcttctcttc ttcctctctc tctatagagc tctctcgctt
tttctgtctc gtggctcgtg gggacggcga ggatggcgac ggcggaggca gcggcggcgg cggcgaggcg aggcggcggc
ggaggcagca atcgcgggga ggcgagtgac ggtgcagggc ggcggcagag gcgagcggcg gcgggagctc gcactgctcg
cggaggaggc gaggcggcgg cggcggcggc ggaagaggcg agcggcggcg gggtgcagcg gaggaggcag cggcggcggc
gaggcgaggc ggtcggcgag cccggtcgag cagcgccccc tccacggcga acccaccggc ggtgacaccg accgccacgc
ctataccctc ccccatcttt cgacggctga ccgccacgcc tctcccctac caaatcaata tcacctggcg ccagacgcat
cataatgcag ccatgcccgc cacatcaact cccctgggat agatcgtcca gcagcggcat caccacagct ctgccgccac
cgctccgtcc gccgtcgccg tcctcgccgt ccccgcgagc cacgagagag agagaataga gagagaggaa gaagagaaga
gtatggcatg cgggtcctac aattttttaa ttaaaaaaac gctgactgga ttgccacgtg tgcgccacgt tggacaaaac
tgctctgaat tggttcgagg gggataattc gtccggtttg catagttggg ggtggagaat gtccggtttt gtgttttaag
ggggtaattc ggacgaccgc gatagttcgg ggggtaattc gtactttttt cctatataaa atatacAATC ATTTATGTGG
GCCTTCTCAT CTTTGTTTAG CCTTTTCAAG TACCTATTGT GACTTGTGTG GTCAAAATCT TTTTCTAAAT TTATGTGGGA
AAAGAACTGA ATCCTGTAAT GCAAATATGC ACGTGTTCCG ACTTGTGAGT TCTTGCTGGT GGATTAGCAT GTTTTGGCCG
TCTCTTGTTA CTTCTGCTTG CCAAAGCGTT TACGGAAGCA TCAAGGTGTT TATAAGAATT ACTATTTACA AAATTACAAG
GTTTTACATT TCGATGACAA AAGTTACATC CACCGAAATT TTTAAGTTTC CAATGTTTTG ATAAATTATT TTTGAACTTC
TTAACAAAAT TTGATCAGCT ACGAGGCCAG CACATACTAC TAGCTAGCGT TGTGCATCTC AATTTTGGAA ATTTCAAACC
TTAATTCGCT ATTTTGGTTG GGCATGCATG TTTGTCCTGT GTCGTCGAAC TGTGCAGCCA TGTTTTTCTT TTGGGATTTT
GTGAGCTAAA ATCCATTCTG GTTCTTTTCA TCAATTGGCT GGCTAGTGGC TCACTTTTCT GGCAGCTGGT CGGTTGCAGT
ACATTCACAA CCTTGAAATT TTGTGATAGC TACTTGGCTG CACTGCATAT GGTGGTTGAT GAGTCCATAC TTTTCTGGTC
CTGAATAATT TGTCTTTTCC AAACGGGTAG TTTGAATTTG CTTTAGTTAC TGGTTATGGT TGTAATTTGC TGAATCTCTT
TTTGCGGTCA TATTTACTAG TATGGCTGTA TCGATGGACA GCTTTGGACG ATCTGCATGA ACGAAATTCA TAAGTCAACA
GAACAGGGTT AAGTCAACTA ATTTGTTTGG TTTCAGTTTG GGGTGTATAC TTTGCATATA GGATCATCTG AATCAAAATC
TTTCTTCTGG CTGCATTACA ATTATGCATT GTAGTAGTTT CTGATAATTA CTTGCAATTC TGCAGGAGCA CTGGAGATGA
CGATGTGGCG ATAAAGATTC TGTTCTGTGG AATCTGCCAC TCTGACCTGC ACTGCATCAA GAATGAGTGG AAGCACTCCA
TCTACCCACT TGTTCCTGGG TAATGGAATT TCCGAAACCC CGCACCGGCA CGCTCAAATC TCGTCCGAAA TTTTCTGTTT
tttacatttt ttttgtgaat ttggtctaat tttatttaaa ttcagtcaaa ttttCAAATA ATTTCGTCTC GAAATTTCTA
AAATTTTGGC AACCCCCGGC ATAAAATCCA ATTTCAAAAT TGAAAACCCT GATCAAGCCT ATATCCATGG CTATCTGCTT
CTGAAAATTT TAAACAAACA CAAGCTTGAA CCTCCCGATC GACGCGTATG CAGGCACGAG ATCGCCGGTG TGGTGACGGA
GGTGGGGAAG AACGTCACCA GGTTCAAGGC CGGCGACAGG GTCGGCGTGG GGTGCATGGT GAACTCGTGC CGGTCATGCG
AGAGCTGTAA CAATGGCTTC GAGAACCACT GCCCGGAGGG CGTCTTCACC TACAACTCCG TCGACAAGGA CGGCACCGTC
ACCTACGGCG GTTACTCGAG CATGGTGGTG GTGCACGAGC GCTTCGTGGT CATGTTCCCG GAGGCGATGC CGCTCGACGT
CGGCGCCCCG CTGCTGTGCG CCGGCATCAC CGTGTACACC CCCATGAAGT ACCACGGCCT GAACGCGCCG GGGAAGCACG
TCGGCGTGCT CGGCCTGGGC GGGCTCGGCC ACGTCGCGGT GAAGTTCGCC AGGGCGTTCG GGTTGAAGGT GACGGTGATC
AGCTCGTCGC CGGGGAAGAA GCGGGAGGCG CTGGAGCGGC TCGGCGCCGA CGCGTTCGTC GTGAGCAGCA GCGCCGAGGA
GATGGAGGCC GCGAGGTCCA CCATGGACGG CGTCATCAAC ACGGTCTCCG CCAACACCCC CATGGCGCCG TACCTGGCGT
TGCTGAAGCC CAACGGGAAG ATGATCCTCG TCGGCCTCCC GGAGAATCCC CTGGAGGTCC CTCCCTTCTC TCTCGTCCAC
GGTAAGCAAG CTCCATCGTC GAGATCGAGC TCGATCGCCA CCGCCACGGC TAGCTGCACC TTGATGATTT ATGATGATGA
TGCAGGGAAC AGGACTCTGG CAGGGAGCAA CATCGGCGGC ATGGCGGACA CGCAGGAGAT GATCGAGCTG GCGGCGAAGC
ACGGCGTGAC GGCGGACATC GAGGTGATCG GCGCCGACGA CGTGAACACG GCCATGGAGC GCCTCGCCAA GGCGGATGTC
AGGTATCGCT TCGTCATCGA CGTCGGGAAC ACCCTCCACG CCGCCGCCGC CGAGTGATGG CATCGCCTGC AAACTATTCG
TGTGGTCTGT AATCTGTATG AAATTGTTCA TGGTACGTAC ACGATATATA GATTGTGGCG TGTCATGGCG TATAGGAATG
AACCCGATCG AGGAAGCTAT TGTTGGTAGT CTGATGCTAG TCAGCTCAGT GTTTGACTGT TTGCATTTAC GGATTGAAAT
TGAGCTTTGT GTGGCCTAAG TTTTATTTTC 

Locus: Os10g0430200

Loading...

Locus: Os10g0430200

Loading...