Os10t0434200-00

Locus

Os10g0434200

Description

Similar to BTB/POZ domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMB34, MB34

Oryzabase Gene Name Synonym(s)

MATH-BTB protein 34, MDC protein with a BTB domain 34, MDC protein having BTB domain 34

Transcript Evidence

AK369602 (DDBJ)

Protein Evidence

Q337W6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

BTB/POZ-like (IPR000210)

MATH (IPR002083)

TRAF-like (IPR008974)

BTB/POZ fold (IPR011333)

BTB/POZ (IPR013069)

TRAF-type (IPR013322)

Expression Databases

TENOR (Os10t0434200-00)

Others

Oryzabase (21228)

Transcript

1101 bp

>Os10t0434200-00 Similar to BTB/POZ domain containing protein.
ATGACGACGACGACGACGGCGGCGGCTGCGGCtctcacgtccagcgtcggtgacggtcct
ccgccgtcgaggtccaccactaccatcaccgcgggacgaacctaccacatactcaagatc
gaggggtactccagcaccttgaaagccggtcgtggccaggccctccgttcctctccgttc
agtgcgggaggtcgcacctggtatatcagctactacccaaacggagggcgagaaaccaac
aagcactgcatctctttcttcatccatcttgacgatgacacggtcaatgacgatgtcatg
gcacaagttacattcagcttgctcgaccgacacaggaatccggtgcggtcacacactgtc
accaccacattgtataacttctcggtggctagtagtaacgcgcttgggttcgaaaacttc
attagaagggacgacttgcaacgatcggaatatctcaatgacgactgcttcgctatcgcg
gttcgtctggtcatcaccgaggaatcaccatccttcacggtgcccccatcgaacatgcac
atggattatggtgatcttctatcaagcaaagagggaaccgatgtcgagtttgtggttggc
ggcgagacatttgccgcacacaggttggtgctagcggcacggtcgccggtgttcaaggcg
gagctattcaaaccaatggaggaaggcaccacggatgtcataaaaattgacaacatggat
gcacaagtgtttaaagctctgcttgtttttatctacacggacacttggccagagataggt
caagacgagacgactatggttcaacaactactcgttgcagccaataagtatagcctatca
agactgaagataatgtgcgaagataagttgtgcagctatattgatacaagttcagtggtt
actatgctgatgctagcagacaagtaccaatgccatggtcttaagaaggtgtgcTTCAAT
TTCCTTGCCTCTTCAAGAGCATTGTCTTTGGTCATGAAAGCAGATAATTTCTGGTGTTTA
ATCCAGAGCCATCCAACTATGTTGAAGGATTTAATTTACAACATCGTTACTCATCAATTG
GAAATTAAATTATCAGTGTAG

CDS

1101 bp

>Os10t0434200-00 Similar to BTB/POZ domain containing protein.
ATGACGACGACGACGACGGCGGCGGCTGCGGCtctcacgtccagcgtcggtgacggtcct
ccgccgtcgaggtccaccactaccatcaccgcgggacgaacctaccacatactcaagatc
gaggggtactccagcaccttgaaagccggtcgtggccaggccctccgttcctctccgttc
agtgcgggaggtcgcacctggtatatcagctactacccaaacggagggcgagaaaccaac
aagcactgcatctctttcttcatccatcttgacgatgacacggtcaatgacgatgtcatg
gcacaagttacattcagcttgctcgaccgacacaggaatccggtgcggtcacacactgtc
accaccacattgtataacttctcggtggctagtagtaacgcgcttgggttcgaaaacttc
attagaagggacgacttgcaacgatcggaatatctcaatgacgactgcttcgctatcgcg
gttcgtctggtcatcaccgaggaatcaccatccttcacggtgcccccatcgaacatgcac
atggattatggtgatcttctatcaagcaaagagggaaccgatgtcgagtttgtggttggc
ggcgagacatttgccgcacacaggttggtgctagcggcacggtcgccggtgttcaaggcg
gagctattcaaaccaatggaggaaggcaccacggatgtcataaaaattgacaacatggat
gcacaagtgtttaaagctctgcttgtttttatctacacggacacttggccagagataggt
caagacgagacgactatggttcaacaactactcgttgcagccaataagtatagcctatca
agactgaagataatgtgcgaagataagttgtgcagctatattgatacaagttcagtggtt
actatgctgatgctagcagacaagtaccaatgccatggtcttaagaaggtgtgcTTCAAT
TTCCTTGCCTCTTCAAGAGCATTGTCTTTGGTCATGAAAGCAGATAATTTCTGGTGTTTA
ATCCAGAGCCATCCAACTATGTTGAAGGATTTAATTTACAACATCGTTACTCATCAATTG
GAAATTAAATTATCAGTGTAG

Protein

367 aa

>Os10t0434200-00 Similar to BTB/POZ domain containing protein.
MTTTTTAAAAALTSSVGDGPPPSRSTTTITAGRTYHILKIEGYSSTLKAGRGQALRSSPF
SAGGRTWYISYYPNGGRETNKHCISFFIHLDDDTVNDDVMAQVTFSLLDRHRNPVRSHTV
TTTLYNFSVASSNALGFENFIRRDDLQRSEYLNDDCFAIAVRLVITEESPSFTVPPSNMH
MDYGDLLSSKEGTDVEFVVGGETFAAHRLVLAARSPVFKAELFKPMEEGTTDVIKIDNMD
AQVFKALLVFIYTDTWPEIGQDETTMVQQLLVAANKYSLSRLKIMCEDKLCSYIDTSSVV
TMLMLADKYQCHGLKKVCFNFLASSRALSLVMKADNFWCLIQSHPTMLKDLIYNIVTHQL
EIKLSV*

CDS

chr10:15466956..15468056 (- strand) : 1101 bp

FASTA

>Os10t0434200-00 class=Sequence position=chr10:15466956..15468056 (- strand)
ATGACGACGA CGACGACGGC GGCGGCTGCG GCtctcacgt ccagcgtcgg tgacggtcct ccgccgtcga ggtccaccac
taccatcacc gcgggacgaa cctaccacat actcaagatc gaggggtact ccagcacctt gaaagccggt cgtggccagg
ccctccgttc ctctccgttc agtgcgggag gtcgcacctg gtatatcagc tactacccaa acggagggcg agaaaccaac
aagcactgca tctctttctt catccatctt gacgatgaca cggtcaatga cgatgtcatg gcacaagtta cattcagctt
gctcgaccga cacaggaatc cggtgcggtc acacactgtc accaccacat tgtataactt ctcggtggct agtagtaacg
cgcttgggtt cgaaaacttc attagaaggg acgacttgca acgatcggaa tatctcaatg acgactgctt cgctatcgcg
gttcgtctgg tcatcaccga ggaatcacca tccttcacgg tgcccccatc gaacatgcac atggattatg gtgatcttct
atcaagcaaa gagggaaccg atgtcgagtt tgtggttggc ggcgagacat ttgccgcaca caggttggtg ctagcggcac
ggtcgccggt gttcaaggcg gagctattca aaccaatgga ggaaggcacc acggatgtca taaaaattga caacatggat
gcacaagtgt ttaaagctct gcttgttttt atctacacgg acacttggcc agagataggt caagacgaga cgactatggt
tcaacaacta ctcgttgcag ccaataagta tagcctatca agactgaaga taatgtgcga agataagttg tgcagctata
ttgatacaag ttcagtggtt actatgctga tgctagcaga caagtaccaa tgccatggtc ttaagaaggt gtgcTTCAAT
TTCCTTGCCT CTTCAAGAGC ATTGTCTTTG GTCATGAAAG CAGATAATTT CTGGTGTTTA ATCCAGAGCC ATCCAACTAT
GTTGAAGGAT TTAATTTACA ACATCGTTAC TCATCAATTG GAAATTAAAT TATCAGTGTA G

Locus: Os10g0434200

Loading...

Locus: Os10g0434200

Loading...