Os10t0434999-00

Locus

Os10g0434999

Description

Similar to BTB/POZ domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMB45, MB45

Oryzabase Gene Name Synonym(s)

MATH-BTB protein 45, MDC protein with a BTB domain 45, MDC protein having BTB domain 45

Transcript Evidence

AK248323 (DDBJ)

Protein Evidence

Q7XE75 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

BTB/POZ-like (IPR000210)

MATH (IPR002083)

TRAF-like (IPR008974)

BTB/POZ fold (IPR011333)

BTB/POZ (IPR013069)

TRAF-type (IPR013322)

Expression Databases

TENOR (Os10t0434999-00)

Others

Oryzabase (21239)

Transcript

1194 bp

>Os10t0434999-00 Similar to BTB/POZ domain containing protein.
ATGGCGACGGCGAGCATCGCGTCCAATGTCGCCGGCGGCGGCTGTCCCACCCCGTCTCGG
TCAGccgccgcctccaccgtcgtcacaacgcaagcctatcacgtgctcaagatcgatggc
tactcccgcaccttacaagtccactgttacagatctctcagttccttcccgttcaacgcg
ggagaccgcacttggtacatctgctactacccacacggaaagaacgacattagcaaggac
ttcatctctatctacctcgttctctatgacgccatcgccgaggctgtcatggtgcaggct
accttcagcctgctcgaccagcacgggaaaccagtgccgtctcacacccacgccacccga
ctgttgagcacttcgaaccaagacgacatggctaacaacctagggtttgaaaccttcatt
gcaaagggcgacttggaaaaatcgggacatgtccaagacgattgcttcgctatcggggtc
catgtggtaatcaccaaggaaacgccgccacccatcatcgcggtgccaccgtcgtcggac
atgcacctgcattacggcgatcttctctcaagtaaacggtgcgccgatgtagagttccta
gttggcggcgagaccttcgccgcgcacagattggtgctcgcggtgcgctcgcctgtcttt
gtggcggagcactttgggccaatgaaggagggtgtaaacgtaaacgacgtgatagagata
aatgacatggatgcacaagtgttcaaagctctacttaacttcatctacacggatacgttg
ctagagatggatcaagaagaagatgcgacaatggctcagcatctacttgttgctgcggac
aaatatggcctagaaaggctaaaggttaaatgcgaagaaaggttgagtaaccacatcgat
gctgactctgtagcaaccctcttggtgctaaccgacaagcacaattgtcgtggtctgaac
aaggcgtgcatcgagttctttagctccccaacAGCACTGGCTAAGATCATAGAAACAGAT
GAATTTCAGTATTTAACCCAAAGCCATCCTAATATTTTGGAGGATATAATTTCTAACATT
GTTGCTTCTCAGTTGGAGAAGGCAATTTTCTCTCCGGAAAATGAGGGAGGCAAAATTAAC
AAGGTAGACATTAGGATTCAGCCATGGCAAAATTCAAATGCCCGATGTGGTTAG

CDS

1194 bp

>Os10t0434999-00 Similar to BTB/POZ domain containing protein.
ATGGCGACGGCGAGCATCGCGTCCAATGTCGCCGGCGGCGGCTGTCCCACCCCGTCTCGG
TCAGccgccgcctccaccgtcgtcacaacgcaagcctatcacgtgctcaagatcgatggc
tactcccgcaccttacaagtccactgttacagatctctcagttccttcccgttcaacgcg
ggagaccgcacttggtacatctgctactacccacacggaaagaacgacattagcaaggac
ttcatctctatctacctcgttctctatgacgccatcgccgaggctgtcatggtgcaggct
accttcagcctgctcgaccagcacgggaaaccagtgccgtctcacacccacgccacccga
ctgttgagcacttcgaaccaagacgacatggctaacaacctagggtttgaaaccttcatt
gcaaagggcgacttggaaaaatcgggacatgtccaagacgattgcttcgctatcggggtc
catgtggtaatcaccaaggaaacgccgccacccatcatcgcggtgccaccgtcgtcggac
atgcacctgcattacggcgatcttctctcaagtaaacggtgcgccgatgtagagttccta
gttggcggcgagaccttcgccgcgcacagattggtgctcgcggtgcgctcgcctgtcttt
gtggcggagcactttgggccaatgaaggagggtgtaaacgtaaacgacgtgatagagata
aatgacatggatgcacaagtgttcaaagctctacttaacttcatctacacggatacgttg
ctagagatggatcaagaagaagatgcgacaatggctcagcatctacttgttgctgcggac
aaatatggcctagaaaggctaaaggttaaatgcgaagaaaggttgagtaaccacatcgat
gctgactctgtagcaaccctcttggtgctaaccgacaagcacaattgtcgtggtctgaac
aaggcgtgcatcgagttctttagctccccaacAGCACTGGCTAAGATCATAGAAACAGAT
GAATTTCAGTATTTAACCCAAAGCCATCCTAATATTTTGGAGGATATAATTTCTAACATT
GTTGCTTCTCAGTTGGAGAAGGCAATTTTCTCTCCGGAAAATGAGGGAGGCAAAATTAAC
AAGGTAGACATTAGGATTCAGCCATGGCAAAATTCAAATGCCCGATGTGGTTAG

Protein

398 aa

>Os10t0434999-00 Similar to BTB/POZ domain containing protein.
MATASIASNVAGGGCPTPSRSAAASTVVTTQAYHVLKIDGYSRTLQVHCYRSLSSFPFNA
GDRTWYICYYPHGKNDISKDFISIYLVLYDAIAEAVMVQATFSLLDQHGKPVPSHTHATR
LLSTSNQDDMANNLGFETFIAKGDLEKSGHVQDDCFAIGVHVVITKETPPPIIAVPPSSD
MHLHYGDLLSSKRCADVEFLVGGETFAAHRLVLAVRSPVFVAEHFGPMKEGVNVNDVIEI
NDMDAQVFKALLNFIYTDTLLEMDQEEDATMAQHLLVAADKYGLERLKVKCEERLSNHID
ADSVATLLVLTDKHNCRGLNKACIEFFSSPTALAKIIETDEFQYLTQSHPNILEDIISNI
VASQLEKAIFSPENEGGKINKVDIRIQPWQNSNARCG*

CDS

chr10:15498122..15499315 (- strand) : 1194 bp

FASTA

>Os10t0434999-00 class=Sequence position=chr10:15498122..15499315 (- strand)
ATGGCGACGG CGAGCATCGC GTCCAATGTC GCCGGCGGCG GCTGTCCCAC CCCGTCTCGG TCAGccgccg cctccaccgt
cgtcacaacg caagcctatc acgtgctcaa gatcgatggc tactcccgca ccttacaagt ccactgttac agatctctca
gttccttccc gttcaacgcg ggagaccgca cttggtacat ctgctactac ccacacggaa agaacgacat tagcaaggac
ttcatctcta tctacctcgt tctctatgac gccatcgccg aggctgtcat ggtgcaggct accttcagcc tgctcgacca
gcacgggaaa ccagtgccgt ctcacaccca cgccacccga ctgttgagca cttcgaacca agacgacatg gctaacaacc
tagggtttga aaccttcatt gcaaagggcg acttggaaaa atcgggacat gtccaagacg attgcttcgc tatcggggtc
catgtggtaa tcaccaagga aacgccgcca cccatcatcg cggtgccacc gtcgtcggac atgcacctgc attacggcga
tcttctctca agtaaacggt gcgccgatgt agagttccta gttggcggcg agaccttcgc cgcgcacaga ttggtgctcg
cggtgcgctc gcctgtcttt gtggcggagc actttgggcc aatgaaggag ggtgtaaacg taaacgacgt gatagagata
aatgacatgg atgcacaagt gttcaaagct ctacttaact tcatctacac ggatacgttg ctagagatgg atcaagaaga
agatgcgaca atggctcagc atctacttgt tgctgcggac aaatatggcc tagaaaggct aaaggttaaa tgcgaagaaa
ggttgagtaa ccacatcgat gctgactctg tagcaaccct cttggtgcta accgacaagc acaattgtcg tggtctgaac
aaggcgtgca tcgagttctt tagctcccca acAGCACTGG CTAAGATCAT AGAAACAGAT GAATTTCAGT ATTTAACCCA
AAGCCATCCT AATATTTTGG AGGATATAAT TTCTAACATT GTTGCTTCTC AGTTGGAGAA GGCAATTTTC TCTCCGGAAA
ATGAGGGAGG CAAAATTAAC AAGGTAGACA TTAGGATTCA GCCATGGCAA AATTCAAATG CCCGATGTGG TTAG

Locus: Os10g0434999

Loading...

Locus: Os10g0434999

Loading...