Os10t0456200-01

Locus

Os10g0456200

Description

Similar to small GTP-binding protein domain.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL8

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 8

Transcript Evidence

AK099701 (DDBJ, Best hit)

Protein Evidence

B9G624 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Ubiquitin (IPR000626)

Ubiquitin supergroup (IPR019955)

Full-length cDNA

J013075D06 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0456200-01)

RiceXPro (AK099701)

Others

Oryzabase (14438)

KEGG (Os10t0456200-01)

Transcript

3368 bp

>Os10t0456200-01 Similar to small GTP-binding protein domain.
GAAGGGGCAATCAGCCAAACAAGTAGGCAGTTGGCAGAGTGGACGGGAGACGGGAGGGAG
GCCACCATGGAGAGCTCGCCGCCGCCGCCGCCGCCGACCATCACCGTCCAGGTCAAGTTC
GGCGGCCGCACGATCCCGGTGGAGGTCCCGGCCGCCGCCACCGCCGCCGACCTGAAGCGC
CTCCTCCAGCCGCTCACCAACGTCCTCCCCCGCGGCCAGAGGCTCATCTGCAAAGGGAAA
GTTCTGGCGGATGCCGCCAGCCTGAGCTCGATGCAGGTGGTGAACGGATCCAAGGTCATG
CTCATGGCCTCGCAGGGGCTCCATCAGGGGGACGGTCCCATCACTAAGAATAGTAGTGTT
CCAGCACCAAGCACGAGAAGAGCCTCAAATGTGAAGGAAGCTCAAATACAAAAGTCGGAT
ACAAATGTCAGTAAAATCCGACCTGAACGTTGGAAAGCAACTGGTATTATTGCATTGTCT
GATTCCAGCTTGAAGGTAACTGATTCCAACTTTCTTACATTACTTTTAAACTAAGCAACT
TAGCGTAGTTATGCTTTGAAGTTCATGAAACTTTCCATGTCTGCCTTTCTATCAAAAGCA
AATTGAAGTGCCTGTGTCAAAACTGCCAATCGTTGGTAAGGAAAAACATGCACATCGCTA
GAGTATTATTTGTATACTTTTGTAGTCACCACAGCCTGTAGAAAATACTATAATAGTCTT
GAACATACTTTCTTTAATGCATCTGTTTGCAAAATGCTATTCATGAATCATGATTGGAAG
ACTGATTTATATGGCACAGGCGCACAGCCATTTGACTGCCGCTATCAACTGAATCAGGAT
TTTCAGTGCATACAAGGCATCTATTATTCATCACCACGTGATAAAGCAGGCCTTTTAGTT
GTTCAGCATTCAAGAACTTCATTGATATTCCTTACTATCCATTATCTTTACCCTTTTGAA
TTAAGAGTCTTATTAGCTGTTTCTCACACTTTTGTTTGTTCAACACTTAGGGTGTGTTTG
GTTGCCTGTATGAAGGGTGGCTCGCATCTCCTCAGCAAAATTCGCTGTGTTTGGTTGCCT
GCATGGGCATGGGAGCCAGGCTCAGCTGATGCAAAAAGGACCGTTGGGCCAGGCTGAGGG
GAAACGCAGGAATCGACCGTAGCTCCTCAGCCAGGCTAGGCTCATGCACACGCGGGGATG
AGCGGGTGCAGCCGCGGGATGAGGGGGTGCAGGCAACGGGCAGGGGTCGAGCCATCTCGC
AATCCCCTCCCCTCATTTGTTTCCTCAGCAATCGGTCGCCGTCGTCTCCATCAGTTTCCC
TCCTCTTCAACGGCTTGAGCCCGGGCAGATCCAGGAGGAAGAAGGCTCGACGAGGGTATC
CAGCCGTCTGGTGAGCTCGAGCTCGGCCATATCCAAGGAAGAAGAGGGCCAGATCCAGGA
GGAAGAAGAGGGCAAGAGGAAGGAGGGCTCAACGAGGATACCCGGATCTGGTCGCTTGGA
GGGCAACGTCGCCACCGCCGGCATCATCTTCCTCCTCTTCTCCTCGTTCTCGCCGGCGCT
GTCTTCTTCGTTGGCTCCCAACTCCCTCCTTCAGGACCTGCGATGTTCCGGATCCAGTGG
GCAGGGCGTCCGGAAGCAACAGATCCGGAGCCACAAACTCCGACGACAGCGACAGACGGG
GCGCAAGGGGGAGGAGCGACGAGCGGCGGTCATGGGCTCTCAGCGTCAGCGGTCTCTGTC
GACCAGCGATGGGGACGAAGGCTTCGAGGGCTTTCTCTTTTCTTTTTTTTTTCCTTCTTT
TCTTCTTTTTCTCGCCGATTAAGCCCGTGATTAGGAACGTTTACTTGTTTTCTTTTTCTT
GCCGATTAAGCACGTGATTAAGGAACGTGTACTGCTACTGCGTAATTTACCGTTTCGATC
TTTTATTTTGTGAAAATTAATAATACAGTCCTGTCATGTTACAATTTATTGAGTTTCTAT
TTGTTCTACCTAATTAAATTTGATACTACATTTTGTTCAAATTTGAAAGATTATAGATTA
GATAATATTTATGTATGGTTGGCTAATATCACCATCCAAATAAAGAGACAATTGAGTTCA
AAgtacatgcatccaaccaaacacaatcttttgcatacaagtttttatatccaaccaacc
aaacaatatctcatacgagccgggctcatctaatacatacaaccaaacaactcctattgc
atcattctaaccaggctaaacccagcctggatgaggcatacgagccaggctgagtgcatt
cgagcaaccaaacacaccctTAATTTCACTTTTGGTTGAATTTTTGGGCTTATACTGTGG
TTGTCTTTTCGAGTAGGCAGTGCCTGAAGAAGTATGGGGCTGTGGTTCTTCTATTAGAGT
ACTGGATGTCAGTAACAACTGTATTGAAGCAATTCCACAAGAAATTGCTGCTCTGAGATC
TTTACAGAAATTGATCCTGACTGCTAATGATATAGCTGATGGGAACATTTCCTGGGAAGG
CCTAACATGTGTTCAAACATTAACAGTTTTATCTCTAAGCCAAAATCGGCTGGTCACTTT
ACCTTCAAGTTTGGGCTCAATAACTCATTTACGTGAACTTCGTATTGCAAATAACAGGCT
TGAGAACTTACCTGTTGAAATAGGGTTACTGAAGCATCTTGAGATTCTGATAGCAAATAA
TAATAGGATAACTTCATTGCCTTCATCTATAGGTGGTTGTGAATCTCTCAATGAGGTTGA
TTTGTCATCAAATCTTTTGGCTGAACTGCCAGAGGCTTTTGGAAACCTTCAACATCTCAA
GGCTTTGAGTGTACGGAACAATGGTCTTACATCCCTACCTTCAGCTTTCTTCATAAAATG
CTCGCAGCTCATTACACTTGATCTCCATGGCACTGAAATCACAAACGACGTTCTTCGGCA
GGTGGACGGTTGGGAGGAGTTTGACGAACGTCGAAGGAAGAAGCATCAAAAGCAGCTCGA
TTTCCGGGTGGGATCATCAGTTGTGTTCGATGAAGGTGCGGATGACGATTACAGGCGTTT
ATAAATAAAATCTCTCTTTGGATAAGATTGTGTATTTTATGTCTCCAGCTTAATCCGTTG
TCGCAAGAATAACTTGTATACTTAAGAACAAATTAGGAGCTGATGTTGCTACTCACATCA
ATCCTAGATATGTACTTGTACTTCATCCTTTTTCAAAATCCCTTCTTTTTAGGGATTCTT
TAAACTGTTTAGGGCATCAAGAGTGGAAAAACATTACTCCGTCCATTTCTATTTACTCGT
GACTGTTGACCAATCCTGTTGTAACTTTGACCACTAATAAATTTTGAATGGTTTGAATTA
TGATGAAC

CDS

468 bp

>Os10t0456200-01 Similar to small GTP-binding protein domain.
ATGGAGAGCTCGCCGCCGCCGCCGCCGCCGACCATCACCGTCCAGGTCAAGTTCGGCGGC
CGCACGATCCCGGTGGAGGTCCCGGCCGCCGCCACCGCCGCCGACCTGAAGCGCCTCCTC
CAGCCGCTCACCAACGTCCTCCCCCGCGGCCAGAGGCTCATCTGCAAAGGGAAAGTTCTG
GCGGATGCCGCCAGCCTGAGCTCGATGCAGGTGGTGAACGGATCCAAGGTCATGCTCATG
GCCTCGCAGGGGCTCCATCAGGGGGACGGTCCCATCACTAAGAATAGTAGTGTTCCAGCA
CCAAGCACGAGAAGAGCCTCAAATGTGAAGGAAGCTCAAATACAAAAGTCGGATACAAAT
GTCAGTAAAATCCGACCTGAACGTTGGAAAGCAACTGGTATTATTGCATTGTCTGATTCC
AGCTTGAAGGTAACTGATTCCAACTTTCTTACATTACTTTTAAACTAA

Protein

156 aa

>Os10t0456200-01 Similar to small GTP-binding protein domain.
MESSPPPPPPTITVQVKFGGRTIPVEVPAAATAADLKRLLQPLTNVLPRGQRLICKGKVL
ADAASLSSMQVVNGSKVMLMASQGLHQGDGPITKNSSVPAPSTRRASNVKEAQIQKSDTN
VSKIRPERWKATGIIALSDSSLKVTDSNFLTLLLN*

5'UTR

chr10:16673399..16673464 (- strand) : 66 bp

CDS

chr10:16673229..16673398 (- strand) : 170 bp

chr10:16673028..16673121 (- strand) : 94 bp

chr10:16671945..16672148 (- strand) : 204 bp

3'UTR

chr10:16670012..16671944 (- strand) : 1933 bp

chr10:16669823..16669923 (- strand) : 101 bp

chr10:16668213..16668350 (- strand) : 138 bp

chr10:16667828..16667876 (- strand) : 49 bp

chr10:16667645..16667710 (- strand) : 66 bp

chr10:16666764..16666883 (- strand) : 120 bp

chr10:16665830..16666256 (- strand) : 427 bp

FASTA

>Os10t0456200-01 class=Sequence position=chr10:16665830..16673464 (- strand)
GAAGGGGCAA TCAGCCAAAC AAGTAGGCAG TTGGCAGAGT GGACGGGAGA CGGGAGGGAG GCCACCATGG AGAGCTCGCC
GCCGCCGCCG CCGCCGACCA TCACCGTCCA GGTCAAGTTC GGCGGCCGCA CGATCCCGGT GGAGGTCCCG GCCGCCGCCA
CCGCCGCCGA CCTGAAGCGC CTCCTCCAGC CGCTCACCAA CGTCCTCCCC CGCGGCCAGA GGCTCATCTG CAAAGGCACC
CGATTCCCCC TCCCCCACCC AAACCCTTGA CCTCCTCCTG ACCGCCAATC TGCTTCCGAT TATAGGTTTT GGATACTTAT
CGTTCTCTTG ATGTGGTTGC AGGGAAAGTT CTGGCGGATG CCGCCAGCCT GAGCTCGATG CAGGTGGTGA ACGGATCCAA
GGTCATGCTC ATGGCCTCGC AGGGGCTCCA TCAGGGGGTA AATTAAATTA ACCGCCTCAT CTTTAGTGTT TTTAGCAATT
AGCTCCTTTT GGAATGTGGT GAGGTACAGT TTGATTTGAG GGAGCCTTTT GTGGTTGCCG AAGTTGAATG ACGATCAGAA
TTCGTTTTGT AGGTGCCTCC ATATGTTAAT TAGCTTGATT TTTTACTCCG ATTCGACACC ATTTCCTCTT AATATTGAGA
TTCGTGAACT GTGATGTTTG GGGTAAATGG CTGAATAGTT TGTAGTACTG TCATATCCTT GACCCAACCG CACCTCAAGG
CAGGATTGCC TATATGCTTT GCCCGTTTGC CGCTTGCGCT AATGTTCTGT GGGACGTCTG CAACAGCCAC TTTTCGCAAC
AAAAATATTT GCCATTTCAC AATTGCTACA AGAAATCAAG GACAAGCTCA GTCTGTGGAA ACATCGCATC AAATGCAGAC
ATCGCAGCCA TATCACCAGC TGGTTACTCG AGCTCAGCTG ATCTATGCTG CATTGCTGCC CCAAATGGGA GTTTGCTGCA
ACAACATCAA GATGAATTAT GCTGTAAAAT TTGCTTTTAT CTTTCTTTTT CCTGTTATAT TTCTTTCTGC ATTTTCTTCT
CTTTCCTTTC TCCCTTTCTC TACTCCTTAT TGTACTTGGT TTTTCCTTTT TTCTCTTCTT TCTTCTTTCT TCTTTTTCTT
TTTTTTTCTC TTTTCTTGTA CCCTCCCCTC TATTTCTCTG TACTCTTGAC CTACCATTAA TACAATGGTT ATAAGGTAGA
GTCTCTCTAC CTTTTTGCTT AAAAAAAAAC CTTATTGCAG TGCCAAAGCA GCGTGAGAAA TCAATTTCTT GTCCAATTCA
TTGTATTGAG CTTACATGTG TTCCACTCTC CAACAGGACG GTCCCATCAC TAAGAATAGT AGTGTTCCAG CACCAAGCAC
GAGAAGAGCC TCAAATGTGA AGGAAGCTCA AATACAAAAG TCGGATACAA ATGTCAGTAA AATCCGACCT GAACGTTGGA
AAGCAACTGG TATTATTGCA TTGTCTGATT CCAGCTTGAA GGTAACTGAT TCCAACTTTC TTACATTACT TTTAAACTAA
GCAACTTAGC GTAGTTATGC TTTGAAGTTC ATGAAACTTT CCATGTCTGC CTTTCTATCA AAAGCAAATT GAAGTGCCTG
TGTCAAAACT GCCAATCGTT GGTAAGGAAA AACATGCACA TCGCTAGAGT ATTATTTGTA TACTTTTGTA GTCACCACAG
CCTGTAGAAA ATACTATAAT AGTCTTGAAC ATACTTTCTT TAATGCATCT GTTTGCAAAA TGCTATTCAT GAATCATGAT
TGGAAGACTG ATTTATATGG CACAGGCGCA CAGCCATTTG ACTGCCGCTA TCAACTGAAT CAGGATTTTC AGTGCATACA
AGGCATCTAT TATTCATCAC CACGTGATAA AGCAGGCCTT TTAGTTGTTC AGCATTCAAG AACTTCATTG ATATTCCTTA
CTATCCATTA TCTTTACCCT TTTGAATTAA GAGTCTTATT AGCTGTTTCT CACACTTTTG TTTGTTCAAC ACTTAGGGTG
TGTTTGGTTG CCTGTATGAA GGGTGGCTCG CATCTCCTCA GCAAAATTCG CTGTGTTTGG TTGCCTGCAT GGGCATGGGA
GCCAGGCTCA GCTGATGCAA AAAGGACCGT TGGGCCAGGC TGAGGGGAAA CGCAGGAATC GACCGTAGCT CCTCAGCCAG
GCTAGGCTCA TGCACACGCG GGGATGAGCG GGTGCAGCCG CGGGATGAGG GGGTGCAGGC AACGGGCAGG GGTCGAGCCA
TCTCGCAATC CCCTCCCCTC ATTTGTTTCC TCAGCAATCG GTCGCCGTCG TCTCCATCAG TTTCCCTCCT CTTCAACGGC
TTGAGCCCGG GCAGATCCAG GAGGAAGAAG GCTCGACGAG GGTATCCAGC CGTCTGGTGA GCTCGAGCTC GGCCATATCC
AAGGAAGAAG AGGGCCAGAT CCAGGAGGAA GAAGAGGGCA AGAGGAAGGA GGGCTCAACG AGGATACCCG GATCTGGTCG
CTTGGAGGGC AACGTCGCCA CCGCCGGCAT CATCTTCCTC CTCTTCTCCT CGTTCTCGCC GGCGCTGTCT TCTTCGTTGG
CTCCCAACTC CCTCCTTCAG GACCTGCGAT GTTCCGGATC CAGTGGGCAG GGCGTCCGGA AGCAACAGAT CCGGAGCCAC
AAACTCCGAC GACAGCGACA GACGGGGCGC AAGGGGGAGG AGCGACGAGC GGCGGTCATG GGCTCTCAGC GTCAGCGGTC
TCTGTCGACC AGCGATGGGG ACGAAGGCTT CGAGGGCTTT CTCTTTTCTT TTTTTTTTCC TTCTTTTCTT CTTTTTCTCG
CCGATTAAGC CCGTGATTAG GAACGTTTAC TTGTTTTCTT TTTCTTGCCG ATTAAGCACG TGATTAAGGA ACGTGTACTG
CTACTGCGTA ATTTACCGTT TCGATCTTTT ATTTTGTGAA AATTAATAAT ACAGTCCTGT CATGTTACAA TTTATTGAGT
TTCTATTTGT TCTACCTAAT TAAATTTGAT ACTACATTTT GTTCAAATTT GAAAGATTAT AGATTAGATA ATATTTATGT
ATGGTTGGCT AATATCACCA TCCAAATAAA GAGACAATTG AGTTCAAAgt acatgcatcc aaccaaacac aatcttttgc
atacaagttt ttatatccaa ccaaccaaac aatatctcat acgagccggg ctcatctaat acatacaacc aaacaactcc
tattgcatca ttctaaccag gctaaaccca gcctggatga ggcatacgag ccaggctgag tgcattcgag caaccaaaca
caccctTAAT TTCACTTTTG GTTGAATTTT TGGGCTTATA CTGTGGTTGT CTTTTCGAGT AGGCAGTGCC TGAAGAAGTA
TGGGGCTGTG GTTCTTCTAT TAGAGTACTG GATGTCAGTA ACAACTGTAT TGAAGCAATT CCACAAGAAA TTGCTGCTCT
GAGATCTTTA CAGGTAATTG TTCTTCCCCA ATATGTTGGT TGAGACATCT TCTTCATTCA CAAGGAAATA TAATTGAATG
TATCATCCTT TCATCTTGTA GAAATTGATC CTGACTGCTA ATGATATAGC TGATGGGAAC ATTTCCTGGG AAGGCCTAAC
ATGTGTTCAA ACATTAACAG TTTTATCTCT AAGCCAAAAT CGGTAGGTCT GATTTTTCAA CATCCTGTTT CATCATGCTA
TGAATATTTG TTTTGTTGCC AGTGGATATA AACAACCCTT TGTAATTTCC TTAAATAATC TTCTCTTTGT GCTCTCAATA
ATGAAAACCG CTAAGCTATA ATTTTTTTTT CTCCAGACTC TTATATATGT TCTTAGATTC ACCCACCTAA TATTTCAAAC
TCCACTTAAA CAGTTAGGCT CATACATTGA AAAGAAAAAT GTAGCAATGC ATAATatctt aagctggttc ttttttgggt
taattagata catgccatta aaaattcacc ggttttgaaa tataccatta ctatttgcgt atttggaacg atgccattga
tatttgtttg taatttcagt ggtgccacta agacacgtat tttgcatgta ttggacgaaa atgccctcat cttctacctc
tatccctctt ctctcatCTT CAAGCTCTCT CTCCCCGCTG CTTCAACTCC ggcgccgtca ccgccgctgc tgctgccgct
gccgcgccgt tgctgttcga tgccgctgct gctcgccgct cgcgctgctg ctcgccgccg ctccgcatgc tgctgccgcc
gcaccgccgc tgccgctcac cgctgccgtt gctccgccgc cgctgccgct cgccgctcgc gccgctgctg ccgttgttac
tcgccgccgc tccgcacgct gccgccgccg ctccgccgct gccgctcgcc gctcgcgcca ttgctgccgt tgctggtcgc
cgcctctccg cacgctgccg gctccgccgc tgccgctcgc tccgccactg ccgctcgctc caccgctgtt gctcgccgct
cgctgctgcc gccgctccgc cgccgctgcc gctgctgccg ttgctgccgc cgctgctccg ccgctgccgc tcgccgctcg
ctccgacgct gccgctgctg ccgctcgctc cgccgccgct tgctccgccg ccgcctgttc tctgagctgt ggaagaagga
gaggggagaa aaagaagcaa agaagggtaa tttggtccaa attttttcgt aaatggtagg tagtggcata tcttgaatat
gtgtaaaatt gtaatggcat ggttccaaat acgcgaatac tgatggtata tttcaaaact gataaatttt taatggtatg
tatctaatta accctTGTTT TTTCTTGAAT AACTGGAAAG GCCTTGAGGT GCTCAGTTTA TCTCAGTGGT TTATGTGGTG
CAAATTGTTC TTGTATCCCT TAATTTTCCT GTCTTGTGCC AGCACCCGTG TCATGCTGGG CCAGCAATAT CAAAGGTGCC
AGGGCAACCT GTCCACGGTA GCAGATTATG GGCATGCTGG CAAGGCACAG TAGACCTTAG GTCTTTATCC ATTAGGAAGT
TTCATGTCCG CCATTATTGT TTAGAATTGA AGATGACGAG ATGATATGTT CTAAATTTAT AATTTTTCAT GCAGGCTGGT
CACTTTACCT TCAAGTTTGG GCTCAATAAC TCATTTACGT GAACTTCGTA TTGCAAATAA CAGGCTTGAG AACTTACCTG
TTGAAATAGG GTTACTGAAG CATCTTGAGA TTCTGATAGC AAATAATAAT AGGTACTGTG CTACTAGTGC TTAACTGAAG
TGACTCATTG AAGTCTCATT TTTTTGCTAT GCTTATAGCA TAATTTACAC TTTGTGCTAA TGTGAAGAGT TACCTCAAGA
GAGGATTTCT GTATATAATA TAGTTGTTGA TAGATTTTTC ACAATCATGT GAGACTTTCA GCCTGTGAGC AGTTCCATTA
TAGAAAAACT TTTAAAGAAA ATGTATTCTA TCAAGCCAGA AAATATGTCT TTTCTTATAC TTCTAATGAG AATTTACATG
ATTACTTTTG TTTTGAGAAT TGAAAGGTAT CCTGACTTCC ACACTGCTAC AATTTCACTT GTTGGCAGGA TAACTTCATT
GCCTTCATCT ATAGGTGGTT GTGAATCTCT CAATGAGGTG TGTGCTTTAT TTCTGTTTCA GTTTTCCTTC TAGTTCTAGG
CCATACTGAG CACTTAGCTC TTCTGAGTTT CCATATGGCA ATTTCTGGTT CATCAAAATT TTTAATTTCA TTAGGTTGAT
TTGTCATCAA ATCTTTTGGC TGAACTGCCA GAGGCTTTTG GAAACCTTCA ACATCTCAAG GTATGTGCCT ATGGGCCACA
CATGGAGAAA TATATTCCTT AATAAAAGAC TAAATCTGCA TGCATACTTC TAAGCTATCT TGTTCCTAGC ATTGAAACAA
GATATTACTA GTGCCCTTGG TTCAAGATGG TACAACTACA TGCTTACTCC CCCATTTTAA GGAAGTTTAA GTTGCATGTT
CATAACCAAT GAACATATAA AAATATTATT TCGCACAACA GTAATGCCAC AACAAACCTG ATATGTGAGT AGTCAGCGTG
AAACATTCCA TGCAATTTTG TGGTATCATG TAGCCTGCAG GTTCAGTTTG AACTTAATTT TTTATTTATT ATCAGCATAC
GGTGGACAAA GTTTTGGCTT ATGACTTGAC AGTTGAGAGA GTCATGAGTA TTTATCGTTC ATTTGTTATA CTCCCTCCGG
TCAAAAatat ttttgtcgga attttaattg tttgaccaaa ccttgtccta aacaacagat atttttgact ggagggagta
TATGATTATT GCACCAGATC GTTATTAAAC TATAGCATTA CTAGCTAAAC TTGGTCAAAA GATTTACTAT CCTGCTGCTT
CTAGTTGTTC ACTGTATATT ATTTATGTCA GAGCAGATGG TTATTTGTGC TTTCCTTTAT GGTGATATTT TTTTTCCATT
CAATATTTTT TCTTTTGTCT AGCATGGGTG TAATAATCAG TTACATTGTA CTGTCATCAG TTTCTAATGT TCCTTTTTTC
AAAATAACTT TATTCCATCA GGCTTTGAGT GTACGGAACA ATGGTCTTAC ATCCCTACCT TCAGCTTTCT TCATAAAATG
CTCGCAGCTC ATTACACTTG ATCTCCATGG CACTGAAATC ACAAACGACG TTCTTCGGCA GGTATAAGTG ACCTAAGTGA
CCCAAGGCTT CACAGTTATG TAGTGTTTGT TACTTTGTTA TGGTCAGTAC TCTACTGAAT TAAGATAGCT ACCAGCATAT
GCTTAAGACC TGGACAGTTC AGTAATCACT CTCTTAAATA GCCTATTGGT TTCACTTTTT GGGACGCCAA AGTTGATACC
CACCACGTTA AATACATAAT ACATAATACC CACAACGTTG ATCAAGTTAT ATAGTTCAGG GTAAACATGT GGTGAAAACC
CCAACTTAGG TGACAACTCG TGTCcatcta catgtgtgat ttattttgat gaatttagac gacttttttg gcttgggttt
acacgagttt tcacctaagt tgGGATTTCC ACCATATATT TACCTTTCCG TTGCGAAAAA GGCGGATAAG TCGTTTATTT
GCTAGCGGTT GCTTTCATTG GTCCTGGCTC TGATGGAGAC ATTTCAACCT TGCCACTGCT AATGCCAGTT TTTACTTGTG
GAAAACAGGT GGACGGTTGG GAGGAGTTTG ACGAACGTCG AAGGAAGAAG CATCAAAAGC AGCTCGATTT CCGGGTGGGA
TCATCAGTTG TGTTCGATGA AGGTGCGGAT GACGATTACA GGCGTTTATA AATAAAATCT CTCTTTGGAT AAGATTGTGT
ATTTTATGTC TCCAGCTTAA TCCGTTGTCG CAAGAATAAC TTGTATACTT AAGAACAAAT TAGGAGCTGA TGTTGCTACT
CACATCAATC CTAGATATGT ACTTGTACTT CATCCTTTTT CAAAATCCCT TCTTTTTAGG GATTCTTTAA ACTGTTTAGG
GCATCAAGAG TGGAAAAACA TTACTCCGTC CATTTCTATT TACTCGTGAC TGTTGACCAA TCCTGTTGTA ACTTTGACCA
CTAATAAATT TTGAATGGTT TGAATTATGA TGAAC

Locus: Os10g0456200

Loading...

Locus: Os10g0456200

Loading...