Os10t0457200-01

Locus

Os10g0457200

Description

Pectate lyase (PEL) precursor, Maintenance of normal cell division, Induction of leaf senescence

RAP-DB Gene Symbol Synonym(s)

DEL1

RAP-DB Gene Name Synonym(s)

dwarf and early-senescence leaf1

CGSNL Gene Symbol

DEL1

CGSNL Gene Name

DWARF AND EARLY-SENESCENCE LEAF 1

Oryzabase Gene Symbol Synonym(s)

OsPLL12, PLL12

Oryzabase Gene Name Synonym(s)

dwarf and early-senescence leaf1, Pectate lyase-like 12

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 28455404

Note

Manual Curation

June 9, 2017

Functional domain (InterPro)

AmbAllergen (IPR018082)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

Pectate lyase/Amb allergen (IPR002022)

Expression Databases

TENOR (Os10t0457200-00)

Others

Oryzabase (22379)

Transcript

2043 bp

>Os10t0457200-01 Pectate lyase (PEL) precursor, Maintenance of normal cell division, Induction of leaf senescence
ATGCCAATCTTCCCCTCCATGAAACATTCTCCATTCTCCCTCCTCCAAAGGCTCAAACAA
ACCCCCTCTTTTAACAAGCAAGGAAGCCATCTCCCCCAGGTGATTCCATTTCACCTCCTC
TCTCTCTCTCTCTCCTCCCCCAGCGAGTTCTCCCCTTCCTCCCCACCATTGCTGTCCAAT
CCCAAGCTCCAAATTAAATCTCAAGAACTTCACCACCCAGCTGCTGATTCTCTCTCCAAA
TCCACCATTTTCCACTCCCTCACTGTGCTCCACACTCTCCTGCATTGCTATAAAAATCCA
CTGCATCTCCAGTTCTCCACTCCCAAATCCACCCAAGAACCAGCCGCCGCCATGGCCGGG
CCCGTCGAATCCACCCGCATTACCCTCCTCCTCGTCGCCGCCACCCTCCTCCTCCTCCCG
CCGCCGCTCGCCGCCTCCCTCAACTCCTCCCTCCCCGACCCCGCCGCCGTCGTCGCCGAC
TTCCACAGCAAGGTGGCGACGTCGCGGCGGCGGATGCAGAAGGCCGACGGCGGCGGCGGC
GGTGGCGGCGGGGGGTGTTtgacggggaaccccatcgaccactgctggcggtgcgccggg
acggactggaggcaggaccggcagcggctggcggactgcggcatcgggttcgggcgcaac
gccatgggcggcaagggcgggccggtgtacgtcgtcaccgacccctccgacggcgacccg
gtgaaccccgcgccggggacgctccggtacggcgccatccaggagggccccctctggatc
gtgttcgccggcgacatgaccatccgcctcaacgaggagctcctcgtgaacagctacaag
accatcgacggccgcggcgccaacgtccacgtcggcgccggcggcgcgtgcatcacgctc
cagtacgtctccaacgtcatcatccacaacatccacgtccacgactgcgtccccgccggc
aacgccaacgtgcgcgcctcgccgacgcactacgggtggcgcacccgctccgacggcgac
ggcatctcgctctactcggcgcgcgacgtgtgggtggaccactgcgcgctgtcgcgctgc
gccgacggcctcatcgacgccatcatggggtccacggcgatcaccgtgtcgaacagctac
ttctcgcaccacaacgaggtgatgctgctggggcacagcgacgggtacctgccggactcg
gcgatgcaggtgaccatcgcgttcaaccacttcgggatccagctcgtgcagcggatgcct
cggtgcaggagggggtacttccacatcgtcaacaacgactacacggcgtgggagatgtac
gccattggagggagcgcgagccccaccatcaacagccagggcaaccgctacatcgccccc
gccgatcccaacgccaaggagGTGACGAAGCGGGTGGACACGGAGGAGGGGCAGTGGGCG
GGGTGGAACTGGAGGACGGAGGGGGACATGATGGTCAACGGCGCCTTCTTCGTCCCCTCC
GGCGAGGGCCTCGAGGCCATCTACGACAAGGCCTCCAGCACCGACCCCAAGTCGTCGGCG
CTCGTCGACCAGCTCACCGCCGGCGCCGGCGTCCTCGGCGGCCCCAGGGACAACGGCGAG
GCGGCGGCGTACGCCGGCGTCAACTACGCCGGAGTTGGAACCGGCGGCGGAGGCGGTGGC
GGCGCCGGTGCCGGCGGGATGGGGTATGGTTATCTCGGGATGGTCTATGGCAGCGGCGGC
AATTGGAGCTGCCGAGCTGACCTGACACTGCAATTGACTTCATTGTTTCTTGCACTCTTT
GCTCTCATATGCTTGCACCCATTGTGATTGTAAGATGCTTCATTATGATTCAATTGGAAA
GGTTAGGAAAAAGGGGAGAAGAAAAAGGAAGCAAAAGGTGTTGACAGTTGACACTTAGGG
AGTAGTAGGCAACAGTGTTACAGTGAGATGATATCCACCATGTAATGAGCACATGGATGG
GAATATTGCAGGTTTAGCCAATGTAGTTGTTGCAAAGGGGAATGGGATTATTCAGACTAA
CTT

CDS

1476 bp

>Os10t0457200-01 Pectate lyase (PEL) precursor, Maintenance of normal cell division, Induction of leaf senescence
ATGGCCGGGCCCGTCGAATCCACCCGCATTACCCTCCTCCTCGTCGCCGCCACCCTCCTC
CTCCTCCCGCCGCCGCTCGCCGCCTCCCTCAACTCCTCCCTCCCCGACCCCGCCGCCGTC
GTCGCCGACTTCCACAGCAAGGTGGCGACGTCGCGGCGGCGGATGCAGAAGGCCGACGGC
GGCGGCGGCGGTGGCGGCGGGGGGTGTTtgacggggaaccccatcgaccactgctggcgg
tgcgccgggacggactggaggcaggaccggcagcggctggcggactgcggcatcgggttc
gggcgcaacgccatgggcggcaagggcgggccggtgtacgtcgtcaccgacccctccgac
ggcgacccggtgaaccccgcgccggggacgctccggtacggcgccatccaggagggcccc
ctctggatcgtgttcgccggcgacatgaccatccgcctcaacgaggagctcctcgtgaac
agctacaagaccatcgacggccgcggcgccaacgtccacgtcggcgccggcggcgcgtgc
atcacgctccagtacgtctccaacgtcatcatccacaacatccacgtccacgactgcgtc
cccgccggcaacgccaacgtgcgcgcctcgccgacgcactacgggtggcgcacccgctcc
gacggcgacggcatctcgctctactcggcgcgcgacgtgtgggtggaccactgcgcgctg
tcgcgctgcgccgacggcctcatcgacgccatcatggggtccacggcgatcaccgtgtcg
aacagctacttctcgcaccacaacgaggtgatgctgctggggcacagcgacgggtacctg
ccggactcggcgatgcaggtgaccatcgcgttcaaccacttcgggatccagctcgtgcag
cggatgcctcggtgcaggagggggtacttccacatcgtcaacaacgactacacggcgtgg
gagatgtacgccattggagggagcgcgagccccaccatcaacagccagggcaaccgctac
atcgcccccgccgatcccaacgccaaggagGTGACGAAGCGGGTGGACACGGAGGAGGGG
CAGTGGGCGGGGTGGAACTGGAGGACGGAGGGGGACATGATGGTCAACGGCGCCTTCTTC
GTCCCCTCCGGCGAGGGCCTCGAGGCCATCTACGACAAGGCCTCCAGCACCGACCCCAAG
TCGTCGGCGCTCGTCGACCAGCTCACCGCCGGCGCCGGCGTCCTCGGCGGCCCCAGGGAC
AACGGCGAGGCGGCGGCGTACGCCGGCGTCAACTACGCCGGAGTTGGAACCGGCGGCGGA
GGCGGTGGCGGCGCCGGTGCCGGCGGGATGGGGTATGGTTATCTCGGGATGGTCTATGGC
AGCGGCGGCAATTGGAGCTGCCGAGCTGACCTGACACTGCAATTGACTTCATTGTTTCTT
GCACTCTTTGCTCTCATATGCTTGCACCCATTGTGA

Protein

491 aa

>Os10t0457200-01 Pectate lyase (PEL) precursor, Maintenance of normal cell division, Induction of leaf senescence
MAGPVESTRITLLLVAATLLLLPPPLAASLNSSLPDPAAVVADFHSKVATSRRRMQKADG
GGGGGGGGCLTGNPIDHCWRCAGTDWRQDRQRLADCGIGFGRNAMGGKGGPVYVVTDPSD
GDPVNPAPGTLRYGAIQEGPLWIVFAGDMTIRLNEELLVNSYKTIDGRGANVHVGAGGAC
ITLQYVSNVIIHNIHVHDCVPAGNANVRASPTHYGWRTRSDGDGISLYSARDVWVDHCAL
SRCADGLIDAIMGSTAITVSNSYFSHHNEVMLLGHSDGYLPDSAMQVTIAFNHFGIQLVQ
RMPRCRRGYFHIVNNDYTAWEMYAIGGSASPTINSQGNRYIAPADPNAKEVTKRVDTEEG
QWAGWNWRTEGDMMVNGAFFVPSGEGLEAIYDKASSTDPKSSALVDQLTAGAGVLGGPRD
NGEAAAYAGVNYAGVGTGGGGGGGAGAGGMGYGYLGMVYGSGGNWSCRADLTLQLTSLFL
ALFALICLHPL*

5'UTR

chr10:16760879..16761229 (- strand) : 351 bp

CDS

chr10:16760742..16760878 (- strand) : 137 bp

chr10:16759753..16760665 (- strand) : 913 bp

chr10:16758777..16758982 (- strand) : 206 bp

chr10:16755875..16756094 (- strand) : 220 bp

3'UTR

chr10:16755659..16755874 (- strand) : 216 bp

FASTA

>Os10t0457200-01 class=Sequence position=chr10:16755659..16761229 (- strand)
ATGCCAATCT TCCCCTCCAT GAAACATTCT CCATTCTCCC TCCTCCAAAG GCTCAAACAA ACCCCCTCTT TTAACAAGCA
AGGAAGCCAT CTCCCCCAGG TGATTCCATT TCACCTCCTC TCTCTCTCTC TCTCCTCCCC CAGCGAGTTC TCCCCTTCCT
CCCCACCATT GCTGTCCAAT CCCAAGCTCC AAATTAAATC TCAAGAACTT CACCACCCAG CTGCTGATTC TCTCTCCAAA
TCCACCATTT TCCACTCCCT CACTGTGCTC CACACTCTCC TGCATTGCTA TAAAAATCCA CTGCATCTCC AGTTCTCCAC
TCCCAAATCC ACCCAAGAAC CAGCCGCCGC CATGGCCGGG CCCGTCGAAT CCACCCGCAT TACCCTCCTC CTCGTCGCCG
CCACCCTCCT CCTCCTCCCG CCGCCGCTCG CCGCCTCCCT CAACTCCTCC CTCCCCGACC CCGCCGCCGT CGTCGCCGAC
TTCCACAGGT AAGCGTGCAC CCCCCGCAAT GCCGGTGCGA TTTTTTCGGA ATCCTTTTTC TTGAGGTTTC TTGGCTAATG
GCAGCAAGGT GGCGACGTCG CGGCGGCGGA TGCAGAAGGC CGACGGCGGC GGCGGCGGTG GCGGCGGGGG GTGTTtgacg
gggaacccca tcgaccactg ctggcggtgc gccgggacgg actggaggca ggaccggcag cggctggcgg actgcggcat
cgggttcggg cgcaacgcca tgggcggcaa gggcgggccg gtgtacgtcg tcaccgaccc ctccgacggc gacccggtga
accccgcgcc ggggacgctc cggtacggcg ccatccagga gggccccctc tggatcgtgt tcgccggcga catgaccatc
cgcctcaacg aggagctcct cgtgaacagc tacaagacca tcgacggccg cggcgccaac gtccacgtcg gcgccggcgg
cgcgtgcatc acgctccagt acgtctccaa cgtcatcatc cacaacatcc acgtccacga ctgcgtcccc gccggcaacg
ccaacgtgcg cgcctcgccg acgcactacg ggtggcgcac ccgctccgac ggcgacggca tctcgctcta ctcggcgcgc
gacgtgtggg tggaccactg cgcgctgtcg cgctgcgccg acggcctcat cgacgccatc atggggtcca cggcgatcac
cgtgtcgaac agctacttct cgcaccacaa cgaggtgatg ctgctggggc acagcgacgg gtacctgccg gactcggcga
tgcaggtgac catcgcgttc aaccacttcg ggatccagct cgtgcagcgg atgcctcggt gcaggagggg gtacttccac
atcgtcaaca acgactacac ggcgtgggag atgtacgcca ttggagggag cgcgagcccc accatcaaca gccagggcaa
ccgctacatc gcccccgccg atcccaacgc caaggaggta agcaagCGAC GCCATTGTTG TTTGCCGTGT TCTTGGCTTC
TTGCTCTCTT CGTTGTTGCT TTGCTTGTGA GTCGTGAGAT GTGATAGCAG AAGGAAAAAA GAAAAATCTT TTTGTGTGTG
TGTGTGTGTT GGATTGGTTT TGGTCTGTTT GTTTCTCATT TCGGCTCGAA TTGCTGATGC TGTCGGATGT TTGATGCCCA
TTTTTGGATG ATTTTATTTT ATTGGGTGGT TATTTCTTGT TCTGTTCATT GGTTTGCTTA TGAAAGGAAA AAAAATGTCT
TTTATTTAGT TGGTTTTCCT CCGTTTGCTT CTCATTTTGG CTCAAATTGC TGAGGTTGTC ACTTGTCAGC TGTTTGATGC
CCCAATTTGG GATGAATTCC TGGTTTAAGT GGGGTGTGAA ATTTAGAGCA ATTTGACCAT ATTTAGAAAA ATTCCCGGTT
AAAGTGGGGT GTGAAATTTA GAGCAATCTG ACCATATTTA GAAAAATTTC TCAAGTCGTT TGACCTGTTT TTAAGGTGTG
AGTAGCGCTC TATGGTCATG TGAATTGCCA CGCTTTTAGG GCGAATGTTT GGAGCATCAT CATAATAGCG CCTCTTCTTT
AAAGAGCAAA AATTTGGGTG AATGTTTTTC CCCCTTGCCC TCGTGATAGC AGCATCCGAG GCAGGCGCGT GCACCGCACG
ATGCGATGCG ATGAGATGAG ATGCACCCTC CCCCAAGATT CGGTGAGGCT GACATGTGGG CCCCACACTG GGACAAAAAA
CGTGCAGGTG ACGAAGCGGG TGGACACGGA GGAGGGGCAG TGGGCGGGGT GGAACTGGAG GACGGAGGGG GACATGATGG
TCAACGGCGC CTTCTTCGTC CCCTCCGGCG AGGGCCTCGA GGCCATCTAC GACAAGGCCT CCAGCACCGA CCCCAAGTCG
TCGGCGCTCG TCGACCAGCT CACCGCCGGC GCCGGCGTCC TCGGCGGCCC CAGGTACGTA CGGCACCCAC CCATCCCTCC
TACATTGCAT CGTCATCGCC TCGCCGGCTC GCCGCTCTCC TTTTGCACGG TCGAATGAAT CCGACATGTA GCAGCAGCGT
GGGTGTGTGG GCCCCACTGC GTGAAATATC CGCCGGATCC CTCTCGCTGA CTGGTGGGGC CCACGTGGGC ATTTTTTTTT
CTTTTGGGTT GGGCCGTCTT TTTTTTAATG CGGCAGCGGC GCCTTTAAAC TGCCACCTCC GGTCGCCGGA GGGGCGCCGC
TTGTCGAGTT GTTGTCGGCG CCATTGCCGC GACCTGGATG GGTAGAGAGG GATTTGCGGT AGAACAGCTC GTCGATTTGG
TAACATTGAG GTCCCGTTGG AAGCATGAAG ATTAGGAAAG GGCACGTAAG ACGAGAGTTA TTAGCACACA TTAATTGATT
TTTAAtccct ccatccaaaa atataatgga ttttgggtgg atgAGTCGTa gggtctgttt ggtacagctc caactcctaa
atttagagga gttgggtctg gagtggatct aattcatttt gtgagagctc catccaactc cactcccagt tctagtggag
ctgaaactgt ttggccaagc tccagctcta gaaggggtgg agctggagct gtgccaaaca ggcccGTACT ATAGTACTAT
GAATCTTGAC AAcatggtac tagaatatat cgcatccatc caaaatccct tatattttag gacagatgga gtagatatta
taaacttaaa aataaacttt atttgatact agtttagatc aacttctata taaaaatttt tcgcacgtaa tatattattt
aacagtttaa aaaaagtgct aatgaaaatt aggaTAGAAT CTAGTAGTAT GATCTTAGTC AGAAACAAAC GGGCCTGAGA
GCATGAGAGC AGAGCAGTTT GGCTAGCTAG CAACAAGCGT GGCAGTACAG TAAGAAATGC AGGCCGGCGA TGCAGGTGGA
CTTGTACAAG CACTCTGACT GGAACTGAGC TAACCATGTC GGCGTCCTAC CGCGATAATC CTACAATTAT TTTCCTGGCC
AAATCCTCAA TTTATAGACC CTTAGCTGGT AAAAGGCAGG ACAGGTTAGG AGGGCCAAAG TAAAGTATTC TTAACAGATG
ATTACTATTA CAAGGCTGAG CACTCAATAG AGAGCCGTAC CACTAACACT AGCGGCTGAC TGACAAAGTC GGGTTGATTA
AACACCGGGA TAAAAGTTTA TAAAGCAACT TTGTCTTGTA CTACCAGTAG GCCCAGTACT TGTATTCTGG TACACTGCTA
GTGCTAGTAT TCTTTTTAGA CAGCGAACTA GACTCTGCTC GTGTGGGATG GGCGAAACGC GAGACTTGGG GAGTGGGCAG
CACGGGCAGG CAAATGCACT GCCGCCGTTG CATTTTCGTT CTCCCGTTCT TTCCTCTGAA ACCATGGCAA GACAAGAGCA
GACTACTCAT GTCAAGCTTA CAAAAACCTT CCAACTATCA TAAAATAAAC AAAACGATGT GACCTAGTAT GAATCTGGAT
AGATCGTATT CGTAATAAGT ATATGTTTAT TTTTGACGGA TGGAGTACAT TTTTACATGA ATGACTTACT CCCTTCGTCC
TAAAAAAAAT CAACTTTTAA AGAAAAATCT AGACAAATGC ATGACCGGAT TTATCTTTAG AATTTGATTT TTTTTTTTAA
AGAACGAAGA GTGTACATCA TTGCGTTAGA CTTTAATACT CCATTCGTTT CTAAAAAATA AACTAATACG GAAATTAGGG
TTGTTTTTTA TACGACGAGG AGGGAATACA TTGCAATGCT AGTACGTTGG CACATAAACT CTCTTCAGTC AATCTGCCTC
CGGATGTCCG GATTATGAAT AAAAAATAAT GGACCAGTGT TATCTTTTGG TAGCCGGTCA TGTCGATGAG CCATCAACTG
AATCCACAGA TGGTGGCCGG TCTTTTTTCC TCTTCGCTCG ATGCCAAAAG TAGCCGGGAT CGAAAAGATC GTCGCATGCT
CAGCAACATG CGTGCTATAT CCATCGATTG CATAACCCAG GGATCACGGT AGGCCGGCAA TCACTCACCA TGCATTGCCT
TCTTCTTCTC CACTTGCTCG CCACTGACCC CTTCGTTTTG TCGCCGAATC CTGCAAAAGA TAGCCAGAAA AGAAAAAAAA
GGCTCAAAAG AAGCTAGTAC ACACAAACAC AAACTGGCCC AATGCATTAT AGTTGTTGCT GAATTATTCT AGTACTGCGA
GAAGCTGTGT TCTTTGGGCG TTTTGGATCT CAAACAGTGT CCTGTACTGG AGACCCTACC ATATTGCAAT GCGATGACCT
TTTCGGATGG AGCCAAGCAA GAAGAGAACG TTGAGGGTCC ATTTGCAACG ATCCATTAGA AAATGGCGTG CACTTTTTGT
CGTTCTGTCC ATCACTCTGC AGGAGAAGAC CCATGTTCCT CGGCATCCAA TTCCTTATTC TGCAGCGTGC ATATGCACTT
GTGACAGACA GCAGTAGTAG ATCTCACCTT AAGTACAGTT TCACTTGAAA GTTTTTGCTA CAACTTGTGC CAGTTTTGCT
AATGACATAC TGGCAGCTAC TAGCTCTCTC ATGGTAGTAC ATGAGAAGAG AATATAAGAT AGTTTGCTAA TGTTTTTGGA
GATTTGATCT GGCAGGGACA ACGGCGAGGC GGCGGCGTAC GCCGGCGTCA ACTACGCCGG AGTTGGAACC GGCGGCGGAG
GCGGTGGCGG CGCCGGTGCC GGCGGGATGG GGTATGGTTA TCTCGGGATG GTCTATGGCA GCGGCGGCAA TTGGAGCTGC
CGAGCTGACC TGACACTGCA ATTGACTTCA TTGTTTCTTG CACTCTTTGC TCTCATATGC TTGCACCCAT TGTGATTGTA
AGATGCTTCA TTATGATTCA ATTGGAAAGG TTAGGAAAAA GGGGAGAAGA AAAAGGAAGC AAAAGGTGTT GACAGTTGAC
ACTTAGGGAG TAGTAGGCAA CAGTGTTACA GTGAGATGAT ATCCACCATG TAATGAGCAC ATGGATGGGA ATATTGCAGG
TTTAGCCAAT GTAGTTGTTG CAAAGGGGAA TGGGATTATT CAGACTAACT T

Locus: Os10g0457200

Loading...

Locus: Os10g0457200

Loading...