Os10t0462800-01

Locus

Os10g0462800

Description

Component of the plastid-encoded plastid RNA polymerase (PEP), peripheral subunit of PEP complex, OsPAP1/OspTAC3, Early chloroplast development

RAP-DB Gene Symbol Synonym(s)

WSL3, OspTAC3, pTAC3

RAP-DB Gene Name Synonym(s)

WHITE STRIPE LEAF 3, white stripe leaf 3, plastid transcriptionally active chromosome protein 3, plastid TAC protein 3

CGSNL Gene Symbol

WSL3

CGSNL Gene Name

WHITE STRIPE LEAF 3

Oryzabase Gene Symbol Synonym(s)

OspTAC3, pTAC3, OsPAP1, PAP1

Oryzabase Gene Name Synonym(s)

white stripe leaf 3, plastid transcriptionally active chromosome protein 3, plastid TAC protein 3, PEP-associated protein 1, plastid-encoded plastid polymerase-associated protein 1

Transcript Evidence

XM_015759431

Protein Evidence

Q8H902

Literature

PMID: 27573887

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

September 8, 2016

Functional domain (InterPro)

SAP domain (IPR003034)

Expression Databases

TENOR (Os10t0462800-01)

Others

Oryzabase (21319)

KEGG (Os10t0462800-01)

Transcript

3019 bp

>Os10t0462800-01 Component of the plastid-encoded plastid RNA polymerase (PEP), peripheral subunit of PEP complex, OsPAP1/OspTAC3, Early chloroplast development
AAACCCCGCCGCGGCCACCATGGCCACCCCTACCCCCACCCCCTCCACCTCCGCCCCCGC
CGCGCCGCCCTCCTCCGCCTTCCCCCTCACTGCCGCCGCGCGCTTCCCCCGCGCGCGCGC
GGCCTCCGCCTCCACCTCCAGCACGCGCGCGTCCGCGCTCGCCGAGCGGCGCCGCACGCG
GCGGCGCCGGCTGCCCGAGGGGAGCGGCGGCGGCGGCGACCGCTCGGCGGCCGCGGGGGC
GGTGGAGAAGGGCCTGCGCCTCGCCTTCCTGGAGCAGCTCGCGGAGCGCGCGCGCGCCGC
GGACGCCGCGGGGGTCGCGGATGCCATCTACGACATGGTCGCCGCGGGGCTCTCCCCCGG
CCCGCGCTCCTTCCACGGCCTCGTCGCCGCCCACGTTCTCGCCGGCGACGCGGAAGGCGC
CATGCAATCTCTTAGAAGGGAGCTAAGTTCTGGGGTGCGCCCTTTACATGAAACATTTGT
GGCTTTAGTCCGTGTTTTTGCCAAGAAGGGTCTTGCTACCAGGGGCATGGAGATTCTGGC
TGCTATGGAAAGATATAAGTATGATATTCGCAAGGCTTGGCTAATTCTTGTAGAGGAACT
AGTCAATAATAACTATCTGGAGGACGCCAATACAGTATTTCTGAAAGGAACAGAAGGTGG
TTTGCAAGGGACTGATGAAATTTATGATCTTTTGATTGAAGAAGATTGTAAAGCTGGAGA
TCACTCCAATGCTCTAACAGTTGCATACAAAATGGAAGCTTCTGGAAGAATGGCAACCAC
ATTCCATTTCAATTGCCTCCTAAGTGTGCAGGCTACTTGTGGAATTCCTGAGATTGCTTT
TGCAACATTCGAAAACATGGAATATGGAGGTGAAGGTTATATGAAACCAGATACCGAGTC
CTACAATTGGGTCATACAGGCATTTACTAGGGCTACATCCTATGACAGGGCAGGAGATGT
GGCCGAATTACTAGGGATGATGGTGGAAGACCACAAACGTATTCAGCCTAATGCAAGAAC
ATATGCGTTGTTAGTGGAATGCTTCACAAAGTACTCTATGGTTAATGAAGCAATAAGGCA
TTTCCGTGCCTTACGGAGAATCCCCGGAGGAACAAAAGTTTTATATAATGAAGGAAATTG
TGGTGATCCGCTTTCTCTCTATCTGCGATCTCTATGCCTTGATGGAAGAGCTGATGAGTT
GCTTGAGGCATTAGAGGCAATGTCTAATGATGGTCAGACTATTGCACCTAGAGCAATGAT
CTTAAACAGAAAATATCGCACGTTGGTGAGCACCTGGATAGAACCATTACAAGAAGAAGC
TGATGTTGGTTTTGAAATTGATTATGTTGCCAGATATATTGAAGAAGGAGGTCTTACTGG
TGAGCGCAAACGCTGGGTGCCTCGAAGAGGCAAAACTCCCTTAGATCCAGATGAGTTTGG
GTTTGCCTATTCAAATCCAATAGAGACATCATTTAAACAGCGCTGCTTTGAGGAATTGAA
GTTATATCATCGCAAACTTCTAATAACATTGAGAAATGAAGGCCCTGGTATTTTAGGTGA
TGTATCTGAAGATGATGTACGAAGAGTTATTGAAAGACTAAAAAAGTTAGTTGTAGGGCC
AAAGAAAAATGTTGTTAAGCCCAAGGCAGCTAGCAAAATGGTAGTATCTGAGTTGAAGAC
TGAGCTAGAGGCACAAGGGTTGCCTACAGATGGAACTAGGCAGGTACTTTACCAGAGAGT
TCAAAAGGCTAGGAGAATCAATCGTTCACGTGGTATACCACTTTGGGTTCCTCCTGTGGA
AGATGAGGAAGAGGTTGATGAAGAGTTAGATGAATTGATTTCACGAATCAAGCTAGAAGA
TGGGAATACAGAGTTTTGGAAGCGGCGTTTCCTGGGAGAAACTCGGAATTATCTTTGTGA
AGAAGTTAATGATGAAGAAGATGCAGATTTAGATGACGATGAGTTGGATGATGATGACGA
CGAAGATGACGACGACGATGATACCACAAAAGGAGAAGAAGATGAGATCGATGAGGAGGA
TGCTGTTGAACAAACGGAAAATCAAGCCGGAGATGAAACTAAAGACAAACCATCGAAAGG
ACCCAAGCAGCATCTTCAAATGATAGGAGTCCAGTTATTAAAGGATCTAGAAAAGACATC
TGTTTCATCAAAGAAGTCAAAAAGGGTACCTGAGATTGATGATGATGAAGATTGGTTTCC
TGAAGACCCAATTGAAGCTTTTAAGGTTATGCGTGAGACAAGGTTGTTCGATGTGTCAGA
TATGTATACTACTGCAGATGCTTGGGGATGGACATGGGAAAGAGAGATAAAGAATAAGAT
GCCACGCAAGTGGTCACAAGAATGGGAGGTTGAGTTGGCTATCAAGATAATGCATAAGGT
GATAGATCTTGGTGGTACCCCAACGATTGGAGATTGTGCCATTATATTGCGGGCTGCAAT
GAGAGTGCCGCTCCCGTCTGCATTTATGACAATATTGCAAACAACGCATAGCCTTGGCTA
CAAATTTGGAAGCCCTCTGTACGACGAGGCGATCTTGCTGTGCCTTGATCTGGAGGAGAT
CGACGCGGCCATTGCGGTGGTAGCAGAAATGGAGACAAATGGAATCAAGGTACCCGACGA
GACCTTGGACAAGGTGCTCGCAGCTAAACAATCTGGTGGAAACTCTGCGCTCCAACCGCC
ACCTGCAGAGGAGTAATCTGATTGGAACAAGAAGCCCCTTTGTAGCCATGATCTAGCACA
CCACATAGAATCATCAGCTCCATGCCATGGATCATTTGTCTTGAGCTCGCCAGATCAACC
TTTGGCAGTGATGTGAGATCACTGCTCTGATGATAATCTGTCAAGGTGGAGAAAGATGAT
CTTATGCTTTGCCCTTGTTGGCCTTCCACTCCACACTCGATGTATTTACAGACAACCAAT
TTTGATACTCCTAGATGAAATGGAATTGAAACTGCTTGGAAGTTGGAACACGACATGTGC
TAGCGTTTGCAGGATTTTA

CDS

2697 bp

>Os10t0462800-01 Component of the plastid-encoded plastid RNA polymerase (PEP), peripheral subunit of PEP complex, OsPAP1/OspTAC3, Early chloroplast development
ATGGCCACCCCTACCCCCACCCCCTCCACCTCCGCCCCCGCCGCGCCGCCCTCCTCCGCC
TTCCCCCTCACTGCCGCCGCGCGCTTCCCCCGCGCGCGCGCGGCCTCCGCCTCCACCTCC
AGCACGCGCGCGTCCGCGCTCGCCGAGCGGCGCCGCACGCGGCGGCGCCGGCTGCCCGAG
GGGAGCGGCGGCGGCGGCGACCGCTCGGCGGCCGCGGGGGCGGTGGAGAAGGGCCTGCGC
CTCGCCTTCCTGGAGCAGCTCGCGGAGCGCGCGCGCGCCGCGGACGCCGCGGGGGTCGCG
GATGCCATCTACGACATGGTCGCCGCGGGGCTCTCCCCCGGCCCGCGCTCCTTCCACGGC
CTCGTCGCCGCCCACGTTCTCGCCGGCGACGCGGAAGGCGCCATGCAATCTCTTAGAAGG
GAGCTAAGTTCTGGGGTGCGCCCTTTACATGAAACATTTGTGGCTTTAGTCCGTGTTTTT
GCCAAGAAGGGTCTTGCTACCAGGGGCATGGAGATTCTGGCTGCTATGGAAAGATATAAG
TATGATATTCGCAAGGCTTGGCTAATTCTTGTAGAGGAACTAGTCAATAATAACTATCTG
GAGGACGCCAATACAGTATTTCTGAAAGGAACAGAAGGTGGTTTGCAAGGGACTGATGAA
ATTTATGATCTTTTGATTGAAGAAGATTGTAAAGCTGGAGATCACTCCAATGCTCTAACA
GTTGCATACAAAATGGAAGCTTCTGGAAGAATGGCAACCACATTCCATTTCAATTGCCTC
CTAAGTGTGCAGGCTACTTGTGGAATTCCTGAGATTGCTTTTGCAACATTCGAAAACATG
GAATATGGAGGTGAAGGTTATATGAAACCAGATACCGAGTCCTACAATTGGGTCATACAG
GCATTTACTAGGGCTACATCCTATGACAGGGCAGGAGATGTGGCCGAATTACTAGGGATG
ATGGTGGAAGACCACAAACGTATTCAGCCTAATGCAAGAACATATGCGTTGTTAGTGGAA
TGCTTCACAAAGTACTCTATGGTTAATGAAGCAATAAGGCATTTCCGTGCCTTACGGAGA
ATCCCCGGAGGAACAAAAGTTTTATATAATGAAGGAAATTGTGGTGATCCGCTTTCTCTC
TATCTGCGATCTCTATGCCTTGATGGAAGAGCTGATGAGTTGCTTGAGGCATTAGAGGCA
ATGTCTAATGATGGTCAGACTATTGCACCTAGAGCAATGATCTTAAACAGAAAATATCGC
ACGTTGGTGAGCACCTGGATAGAACCATTACAAGAAGAAGCTGATGTTGGTTTTGAAATT
GATTATGTTGCCAGATATATTGAAGAAGGAGGTCTTACTGGTGAGCGCAAACGCTGGGTG
CCTCGAAGAGGCAAAACTCCCTTAGATCCAGATGAGTTTGGGTTTGCCTATTCAAATCCA
ATAGAGACATCATTTAAACAGCGCTGCTTTGAGGAATTGAAGTTATATCATCGCAAACTT
CTAATAACATTGAGAAATGAAGGCCCTGGTATTTTAGGTGATGTATCTGAAGATGATGTA
CGAAGAGTTATTGAAAGACTAAAAAAGTTAGTTGTAGGGCCAAAGAAAAATGTTGTTAAG
CCCAAGGCAGCTAGCAAAATGGTAGTATCTGAGTTGAAGACTGAGCTAGAGGCACAAGGG
TTGCCTACAGATGGAACTAGGCAGGTACTTTACCAGAGAGTTCAAAAGGCTAGGAGAATC
AATCGTTCACGTGGTATACCACTTTGGGTTCCTCCTGTGGAAGATGAGGAAGAGGTTGAT
GAAGAGTTAGATGAATTGATTTCACGAATCAAGCTAGAAGATGGGAATACAGAGTTTTGG
AAGCGGCGTTTCCTGGGAGAAACTCGGAATTATCTTTGTGAAGAAGTTAATGATGAAGAA
GATGCAGATTTAGATGACGATGAGTTGGATGATGATGACGACGAAGATGACGACGACGAT
GATACCACAAAAGGAGAAGAAGATGAGATCGATGAGGAGGATGCTGTTGAACAAACGGAA
AATCAAGCCGGAGATGAAACTAAAGACAAACCATCGAAAGGACCCAAGCAGCATCTTCAA
ATGATAGGAGTCCAGTTATTAAAGGATCTAGAAAAGACATCTGTTTCATCAAAGAAGTCA
AAAAGGGTACCTGAGATTGATGATGATGAAGATTGGTTTCCTGAAGACCCAATTGAAGCT
TTTAAGGTTATGCGTGAGACAAGGTTGTTCGATGTGTCAGATATGTATACTACTGCAGAT
GCTTGGGGATGGACATGGGAAAGAGAGATAAAGAATAAGATGCCACGCAAGTGGTCACAA
GAATGGGAGGTTGAGTTGGCTATCAAGATAATGCATAAGGTGATAGATCTTGGTGGTACC
CCAACGATTGGAGATTGTGCCATTATATTGCGGGCTGCAATGAGAGTGCCGCTCCCGTCT
GCATTTATGACAATATTGCAAACAACGCATAGCCTTGGCTACAAATTTGGAAGCCCTCTG
TACGACGAGGCGATCTTGCTGTGCCTTGATCTGGAGGAGATCGACGCGGCCATTGCGGTG
GTAGCAGAAATGGAGACAAATGGAATCAAGGTACCCGACGAGACCTTGGACAAGGTGCTC
GCAGCTAAACAATCTGGTGGAAACTCTGCGCTCCAACCGCCACCTGCAGAGGAGTAA

Protein

899 aa

>Os10t0462800-01 Component of the plastid-encoded plastid RNA polymerase (PEP), peripheral subunit of PEP complex, OsPAP1/OspTAC3, Early chloroplast development
MATPTPTPSTSAPAAPPSSAFPLTAAARFPRARAASASTSSTRASALAERRRTRRRRLPE
GSGGGGDRSAAAGAVEKGLRLAFLEQLAERARAADAAGVADAIYDMVAAGLSPGPRSFHG
LVAAHVLAGDAEGAMQSLRRELSSGVRPLHETFVALVRVFAKKGLATRGMEILAAMERYK
YDIRKAWLILVEELVNNNYLEDANTVFLKGTEGGLQGTDEIYDLLIEEDCKAGDHSNALT
VAYKMEASGRMATTFHFNCLLSVQATCGIPEIAFATFENMEYGGEGYMKPDTESYNWVIQ
AFTRATSYDRAGDVAELLGMMVEDHKRIQPNARTYALLVECFTKYSMVNEAIRHFRALRR
IPGGTKVLYNEGNCGDPLSLYLRSLCLDGRADELLEALEAMSNDGQTIAPRAMILNRKYR
TLVSTWIEPLQEEADVGFEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDEFGFAYSNP
IETSFKQRCFEELKLYHRKLLITLRNEGPGILGDVSEDDVRRVIERLKKLVVGPKKNVVK
PKAASKMVVSELKTELEAQGLPTDGTRQVLYQRVQKARRINRSRGIPLWVPPVEDEEEVD
EELDELISRIKLEDGNTEFWKRRFLGETRNYLCEEVNDEEDADLDDDELDDDDDEDDDDD
DTTKGEEDEIDEEDAVEQTENQAGDETKDKPSKGPKQHLQMIGVQLLKDLEKTSVSSKKS
KRVPEIDDDEDWFPEDPIEAFKVMRETRLFDVSDMYTTADAWGWTWEREIKNKMPRKWSQ
EWEVELAIKIMHKVIDLGGTPTIGDCAIILRAAMRVPLPSAFMTILQTTHSLGYKFGSPL
YDEAILLCLDLEEIDAAIAVVAEMETNGIKVPDETLDKVLAAKQSGGNSALQPPPAEE*

5'UTR

chr10:17040029..17040047 (+ strand) : 19 bp

CDS

chr10:17040048..17040449 (+ strand) : 402 bp

chr10:17041832..17042003 (+ strand) : 172 bp

chr10:17042081..17042298 (+ strand) : 218 bp

chr10:17042657..17042720 (+ strand) : 64 bp

chr10:17042915..17042987 (+ strand) : 73 bp

chr10:17043460..17043537 (+ strand) : 78 bp

chr10:17043739..17043896 (+ strand) : 158 bp

chr10:17044388..17044556 (+ strand) : 169 bp

chr10:17044697..17045156 (+ strand) : 460 bp

chr10:17045264..17045644 (+ strand) : 381 bp

chr10:17046000..17046203 (+ strand) : 204 bp

chr10:17046484..17046617 (+ strand) : 134 bp

chr10:17047103..17047286 (+ strand) : 184 bp

3'UTR

chr10:17047287..17047589 (+ strand) : 303 bp

FASTA

>Os10t0462800-01 class=Sequence position=chr10:17040029..17047589 (+ strand)
AAACCCCGCC GCGGCCACCA TGGCCACCCC TACCCCCACC CCCTCCACCT CCGCCCCCGC CGCGCCGCCC TCCTCCGCCT
TCCCCCTCAC TGCCGCCGCG CGCTTCCCCC GCGCGCGCGC GGCCTCCGCC TCCACCTCCA GCACGCGCGC GTCCGCGCTC
GCCGAGCGGC GCCGCACGCG GCGGCGCCGG CTGCCCGAGG GGAGCGGCGG CGGCGGCGAC CGCTCGGCGG CCGCGGGGGC
GGTGGAGAAG GGCCTGCGCC TCGCCTTCCT GGAGCAGCTC GCGGAGCGCG CGCGCGCCGC GGACGCCGCG GGGGTCGCGG
ATGCCATCTA CGACATGGTC GCCGCGGGGC TCTCCCCCGG CCCGCGCTCC TTCCACGGCC TCGTCGCCGC CCACGTTCTC
GCCGGCGACG CGGAAGGCGC CGTAAGTGCA CCCAACCATC TTAAAACTGT TACTGTAATC GTGTGGGATT TAGAGAATTC
CCGCTTGTTT GATGAAATGC GAGCGAAACT GTTACTGTAA TTGTGTGGGA TTTAGAGAAT TCCCGCGTGT TTGATGAAAT
GCGAGCGGTC CACTCGATGT GTTTCTCGGT GTCTGTGCTG AGTTGTGGAA TTGAGCGTTT CCGCGGTTGG CAATTGTTGG
TCGAGTTTTA TGTCGCAGAG TTGTGATCCC ATGGTGGTCT ACTTCAGTGA AAATGTTGTT CATTGTGAGA AGTTGCTTGA
ATGTTCCGTG ATGGGTTTGT GCAACGTGGA GCCGCATTCT GCAAGCCCTC AAACTATCGG GTGGTGAGGA ACTGAGGATA
GGCTAAGTTT AAACTCTCCA TTCACGTCGT TATTGTAGGA TTGACTTAGG TTTGTATCAC GTTTAGTAAA TGTCCCTACC
CCCATTTTTT TTATTTAAAA AAGTTGCTAG CCTTGTCCTT GTAGCCTTGC AAAGCTTCAG AATGAATCTA GTGTTATGCT
AGTTTTTTTT TTAATCTGAT ATTGGGATTG ATGCATAATA TATTGGAGTT AATGCAGTAT AGTCAACTTA TACAAGGATT
CAGTATGTCT TTTGGCTGCT GTTAATTAGC TGATTGGATG TTGCACAGAT TCGTAAAGCT TGTATCTGGT GTATCTTACT
CGAGCATTTG GAACCTATTT TTGTTCCAGA AACAGAAATA GTAAACTTCA GCTAGCTTTC AGGGTAAAAG AAATCTGGGT
GTGTATTTCT TCTTAATTAA AAATACCACC TAGTTCCTCC TAGGTTGGTC AAGTTTTTAC AAGGTAAAAG AAAACAGTTT
TTCAAGTCAA GTACTAAATG GTGTTAGAAC CACAAGGGGC AAACATTGCC CCCTACTTTG CGTGATCCCA TCTCCCGCAA
ATGCAATACA TGAATAACTT CTTCCTTATA ATCATCTTCT AGAATAGATT GTATATAACA CATGTTTTGT TTTGATATCT
GATTTAATGT CAAATGCTAG ATAGGCATAT TTAAAAGAAC AATAAAATGT GTACAGGTAT TAAGCCACCA ATCATGTGGC
TGAGCACTGT TTGTTTTGGA TTCACTCCTG TAATAAGTTT AATCTTTGAT TGTGTGATTT ATTTTGGTGA TAGATCTAAA
CTTATTGTAG GCCTACATGT CCTAAGTTTA TAGTAGGTGC TTAATTGTTC CCGCAGAACT TTCTTGAATC TCATGAATAA
TAAGTGTACT TGAAGTAAAC ATAACTATAT TTCTTCCATG AGATTTTTTT AGATAATGAT TTCTTCTATG AGATACATGC
ACAGGTTTAG GAAAATGATA ATGCTATACT TTTTTTGATA CAGATGCAAT CTCTTAGAAG GGAGCTAAGT TCTGGGGTGC
GCCCTTTACA TGAAACATTT GTGGCTTTAG TCCGTGTTTT TGCCAAGAAG GGTCTTGCTA CCAGGGGCAT GGAGATTCTG
GCTGCTATGG AAAGATATAA GTATGATATT CGCAAGGCTT GGCTAATTCT TGTAGGTATG TAAATCGCTC TGCATCTCAT
ATTTTATTTT TATTAATTTT AATGACATAG TAGTCTTCTT TCTATGGAAC AGAGGAACTA GTCAATAATA ACTATCTGGA
GGACGCCAAT ACAGTATTTC TGAAAGGAAC AGAAGGTGGT TTGCAAGGGA CTGATGAAAT TTATGATCTT TTGATTGAAG
AAGATTGTAA AGCTGGAGAT CACTCCAATG CTCTAACAGT TGCATACAAA ATGGAAGCTT CTGGAAGAAT GGCAACCACA
TTCCATTTCA ATTGCCTCCT AAGTGTGCAG GTGATACTAT GAGCTTGATT TGCATATAGC AAAATAGCCA TACTTATGAT
TGTTTCTTTT CTGCCTTAAT TTGCTTAGCT AACCTATCAG CATTTCGTAA AGAAAAAGAA ATAAATACCT GTCAATTAAT
TTCCAAATAG AATATGAGCT CCACACGGAC TGCACATCGT GCATCTATTG CACTTGGTGA TATGAATATA TAAGTGCTAT
ACTAGTTCTC TCTCTCACAC ACACGCCTGC AGTCCGCGTA GCTAAAGAAA AACTAGGTTT GGTTTATTTT AAGAACATAC
TTATTGCGGT TCATATTTAC AAATATAGTC ACTTTTTTCC TTTACATAAA AGTTTGTATT TCATTCAGGC TACTTGTGGA
ATTCCTGAGA TTGCTTTTGC AACATTCGAA AACATGGAAT ATGGAGGTGA AGGTATAGCC ATCATTTACA CTGGTCTTCT
TTTATGGTGT CATTATTTAT TTTGTTTACT TTTTAGTTTA TCAACAGCGT GATTTCACGC TATAAATAAC TTGTTGAAGA
ATTGACATGT GCAATCTTGA TGTTTTATGA CTTCATATCC TGGGATTTTG ACTAAAGTCT ATACTGATTT CACTTTATCA
TTCTAGGTTA TATGAAACCA GATACCGAGT CCTACAATTG GGTCATACAG GCATTTACTA GGGCTACATC CTATGACAGG
TACACTTAAT AGAGATGTTC TCTGCAATAT TTGTTTGCTA TGTTCTGTTG GTTCCTTTTG AATTTAGTCT GTTGTCAACA
CAGTTATACA ATCATGGATT CATGCTGAAT TCATTTTAGC ATCAGAGTCA ACTGCTTGAA CCCAATGATT TGATGATGTA
AAATAAGCAT ACCAATAGCC ATAGCTCCAT GGAGCATGAA GGGAAAGCTC TAAAAGTGGC AACAACTTGT TGTTTCTTAT
TGGATATTAT ATTCAACACA TAAAACTATT CAGAAGAAGC AAGCTGTGAA AACTGGAAAC CATAGCTGTA TCCAGCATTT
TTTCCAGTAT TCATCAAGAT ACTTGAAGAC AGATATCTTT CACATGACTT ATTTTTTGTC ATTTTCTATA TCCCTGCTAC
ATATTTGAAT TTTTTTCAGG AGAATGCTAT ATGTTGTTTT TTTTTTAAAA ATAATGTGTT TTTGTCTTCA GGGCAGGAGA
TGTGGCCGAA TTACTAGGGA TGATGGTGGA AGACCACAAA CGTATTCAGC CTAATGCAAG AACATATGCG TAAGTACAGA
GCTACAATCT TACAAAATTA TACCAAAGCC ACCATAGAAT AGTTGATAGT CTACTCTATA ATGAGGAGGC AAGCACACTG
TCAAGTCTGA CTTCTGAATG TCAATAGCCA TTCTTGTTTG CTTACTCTTA TCCTTGTCAA TTTTTTTTCT CTTGGAAAAC
AATGTTCTGA TGATCAGCAA CTATTGCCAG GTTGTTAGTG GAATGCTTCA CAAAGTACTC TATGGTTAAT GAAGCAATAA
GGCATTTCCG TGCCTTACGG AGAATCCCCG GAGGAACAAA AGTTTTATAT AATGAAGGAA ATTGTGGTGA TCCGCTTTCT
CTCTATCTGC GATCTCTATG CCTTGATGGT GAGCATTGTC CCTTCTGTGC AGTACTTAAG ATGGAAATGT GGAGTCCTGT
GGCATATTCT TATAATTATT CTTGAGTACT GTCTGAAATG GTTGACTTAT TCTTATCATA AGTCCTGTGG CAGACGATGG
TATATGGAAG TGGTTATTTT AATTATAATT TCATCCCTTT CTTTGTGTGC ATATGCATAG TTTGTAATAC CTTGTGGAGT
GATTCCTTTT AACCTCATTA TTAACTAATT ATAAATTCTT ACTTTCCTGG TTATAATCTC TTATTTTGAC AGCTCTTGGC
ACTAGGAACC CATAACATCA AAACACACCC GTGAAAATTA CATAGTTATA TTTATTACAA CAGTAGTTCC ATACTTCCAT
TTCTGTATTC TGTACTCAAT ATATAAATCA TTTGTCTTCC ATACTTTTAG TTTTAGGAGA CTTTGCACTA TTATGAACTT
TAAAACTTTC CTGAGCAGGT AACTTATTTT TATAACCAGG AAGAGCTGAT GAGTTGCTTG AGGCATTAGA GGCAATGTCT
AATGATGGTC AGACTATTGC ACCTAGAGCA ATGATCTTAA ACAGAAAATA TCGCACGTTG GTGAGCACCT GGATAGAACC
ATTACAAGAA GAAGCTGATG TTGGTTTTGA AATTGATTAT GTTGCCAGGT ATGATTGAGA GGTTTAGGTT CTTACTTTAC
TGTTAAAGAT GACAAGTCAG TTTTTGTCAA TCACATATTC ATATTTGCCA ACAACACTCC ATAATTATGT AATGTGCATT
AGTTTTTTCA TTCATATTGT CTTTGTAGAT ATATTGAAGA AGGAGGTCTT ACTGGTGAGC GCAAACGCTG GGTGCCTCGA
AGAGGCAAAA CTCCCTTAGA TCCAGATGAG TTTGGGTTTG CCTATTCAAA TCCAATAGAG ACATCATTTA AACAGCGCTG
CTTTGAGGAA TTGAAGTTAT ATCATCGCAA ACTTCTAATA ACATTGAGAA ATGAAGGCCC TGGTATTTTA GGTGATGTAT
CTGAAGATGA TGTACGAAGA GTTATTGAAA GACTAAAAAA GTTAGTTGTA GGGCCAAAGA AAAATGTTGT TAAGCCCAAG
GCAGCTAGCA AAATGGTAGT ATCTGAGTTG AAGACTGAGC TAGAGGCACA AGGGTTGCCT ACAGATGGAA CTAGGCAGGT
ACTTTACCAG AGAGTTCAAA AGGCTAGGAG AATCAATCGT TCACGTGGTA TACCACTTTG GGTTCCTCCT GTGGAAGATG
AGGAAGAGGT AAGTTGACAA TATTTACTGC ATTAGTCCTA TTTGGTGGTG TTATCATGTG AGAAATGTTA CCTGCTATTT
TTTGCTGAAG TTTTAAAGTA CAACACTATT GATAGGTTGA TGAAGAGTTA GATGAATTGA TTTCACGAAT CAAGCTAGAA
GATGGGAATA CAGAGTTTTG GAAGCGGCGT TTCCTGGGAG AAACTCGGAA TTATCTTTGT GAAGAAGTTA ATGATGAAGA
AGATGCAGAT TTAGATGACG ATGAGTTGGA TGATGATGAC GACGAAGATG ACGACGACGA TGATACCACA AAAGGAGAAG
AAGATGAGAT CGATGAGGAG GATGCTGTTG AACAAACGGA AAATCAAGCC GGAGATGAAA CTAAAGACAA ACCATCGAAA
GGACCCAAGC AGCATCTTCA AATGATAGGA GTCCAGTTAT TAAAGGATCT AGAAAAGACA TCTGTTTCAT CAAAGAAGTC
AAAAAGGGTA CCTGAGGTAT GAAAGTGATG TGTCAACATT GTATGCAATG GCTCTTGATT GACCTTTCTA TTGCAAATTA
ATTCTCCCAT TGATCTGATG CTTGCAATCA TCTCAATTGA ATGGTTCATG TCGTGTTAAC AACTTAAATT CAACATAAAG
GAACATAATG TAAGGAATAT ACCTGTACAT AATATATATA ATATTTTAAG TTTTGGAACA TATCCTCTAG GACTTGCAGG
CTGTATAGTG TAACCAATAA ATCACGAAAA GTCTCTGCTT TCTTCTAATT TTGTTACATC AGCTACATAT GATACTAAGA
GCTAATCTCT CAGTATCATT ACAAATTTTG AGTCATTTCC TGCCTTTGTA GATTGATGAT GATGAAGATT GGTTTCCTGA
AGACCCAATT GAAGCTTTTA AGGTTATGCG TGAGACAAGG TTGTTCGATG TGTCAGATAT GTATACTACT GCAGATGCTT
GGGGATGGAC ATGGGAAAGA GAGATAAAGA ATAAGATGCC ACGCAAGTGG TCACAAGAAT GGGAGGTTGA GTTGGCTATC
AAGATAATGC ATAAGGTATT CAGCTTTATA GCTAAAGTTT TAGAGCTGGT CTCTTTGTCT GGCATTGCTC CATGGACTTT
GTGGTTCTGT TTGGTTAACT GTCTTCTCTT ATGGAGCTGT GGATTTTGTG GACTATGGGA TGCTGAGATT AGTTCCATTA
CTATATTCAG TTTACATCAC ATTTGTTATT GTTTTAGGTT AGCCTGTTAT GACATGATAG GGTTTTGAGC TTGCACCAAA
ATTGTTGATG TTTGAATTAT GGATTGTGTC ATATGGCTGT TATGTTAACT TTCAGGTGAT AGATCTTGGT GGTACCCCAA
CGATTGGAGA TTGTGCCATT ATATTGCGGG CTGCAATGAG AGTGCCGCTC CCGTCTGCAT TTATGACAAT ATTGCAAACA
ACGCATAGCC TTGGCTACAA ATTTGGAAGG TAAAACTTTG GGCTCTCCAT ATATATGTAA AGATTTCCGT TTGTAAATCA
GTCCGACTGT CTAGTGATGT TTTTGTTGCT ATATAAGTTT TGAGTTTGAA GCCCATATAA TGATGTGTTT TTTGAATTTA
TAACAAAACA TAACAAAACT ACAATTTTTA ACTCCTAAGA CATATTTTTG ATCTGTAGCT CATGCTGCAC TGGATTAACC
ACTGCTCTTG ATCCACACAT GTGTAGGCTG CCGCATTGTT GCAATATTTA GCTTACATTT TTGTCTATTC AAATAGAATT
AAAAAGTTTG GGCTATTCTT TATGATTTGA TTCATATTTT GCTTATACAC ACTGTCAACA TGTTCTTACC TTTGCTTAAA
GCCCACATCA ACAGAGTTAT CTGTAGTTTC TGAATCAAAA TTTACACGCT TGACAGTCTG TACTAACAAA CCTTCCCTTC
TTTTGTTTTT TTTTTCTTAT GCACCTGGAC TTAGCCCTCT GTACGACGAG GCGATCTTGC TGTGCCTTGA TCTGGAGGAG
ATCGACGCGG CCATTGCGGT GGTAGCAGAA ATGGAGACAA ATGGAATCAA GGTACCCGAC GAGACCTTGG ACAAGGTGCT
CGCAGCTAAA CAATCTGGTG GAAACTCTGC GCTCCAACCG CCACCTGCAG AGGAGTAATC TGATTGGAAC AAGAAGCCCC
TTTGTAGCCA TGATCTAGCA CACCACATAG AATCATCAGC TCCATGCCAT GGATCATTTG TCTTGAGCTC GCCAGATCAA
CCTTTGGCAG TGATGTGAGA TCACTGCTCT GATGATAATC TGTCAAGGTG GAGAAAGATG ATCTTATGCT TTGCCCTTGT
TGGCCTTCCA CTCCACACTC GATGTATTTA CAGACAACCA ATTTTGATAC TCCTAGATGA AATGGAATTG AAACTGCTTG
GAAGTTGGAA CACGACATGT GCTAGCGTTT GCAGGATTTT A