Os10t0467800-01

Locus

Os10g0467800

Description

Secondary wall-specific cellulose synthase, Secondary cell wall formation

RAP-DB Gene Symbol Synonym(s)

CESA7, OsCesA7, OsCESA7, OS_CESA07, OsCesA 7, CesA7

RAP-DB Gene Name Synonym(s)

CELLULOSE SYNTHASE A7, Cellulose synthase A catalytic subunit 7 [UDP-forming], Cellulose synthase A catalytic subunit 7

CGSNL Gene Symbol

CESA7

CGSNL Gene Name

CELLULOSE SYNTHASE A7

Oryzabase Gene Symbol Synonym(s)

OsCesA7, OsCESA7, OS_CESA07, OsCesA 7, CesA7

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 7 [UDP-forming], Cellulose synthase A catalytic subunit 7

Transcript Evidence

AK072259

Protein Evidence

Q9AV71

Literature

PMID: 26070439

PMID: 12970476

Note

Manual Curation

June 9, 2016

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Cellulose synthase, RING-type zinc finger (IPR027934)

Nucleotide-diphospho-sugar transferases (IPR029044)

Full-length cDNA

J023009D02 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0467800-01)

RiceXPro (AK072259)

Others

Oryzabase (6113)

KEGG (Os10t0467800-01 (EC:2.4.1.12))

Transcript

3425 bp

>Os10t0467800-01 Secondary wall-specific cellulose synthase, Secondary cell wall formation
GCCCACCAACGTCGCTTCCCCGGCACCTCACCATGGACACCGCCTCCGTCACCGGTGGCG
AGCACAAGGGGAAGGAGAAGACGTGCCGGGTGTGCGGCGAGGAGGTGGCGGCGAGGGAGG
ACGGGAAGCCGTTCGTGGCGTGCGCCGAGTGCGGCTTCCCGGTGTGCAAGCCCTGCTACG
AGTACGAGCGCAGCGAGGGCACCCAGTGCTGCCCCCAGTGCAACACCCGCTACAAGCGCC
ACAAAGGGTGCCCACGGGTGGAAGGCGACGAGGACGACGGCGGCGACATGGACGACTTCG
AGGAGGAGTTCCAGATCAAGAGCCCCACCAAGCAGAAACCCCCCCACGAGCCCGTCAACT
TCGACGTCTACTCGGAGAACGGCGAGCAGCCGGCACAGAAGTGGCGCCCTGGAGGCCCGG
CGCTCTCTTCCTTCACCGGAAGCGTGGCTGGGAAGGATCTGGAGCAGGAGAGGGAGATGG
AGGGTGGCATGGAGTGGAAGGACAGGATCGACAAGTGGAAGACGAAGCAGGAGAAGCGGG
GCAAGCTCAACCGCGACGACAGCGACGACGACGACGACAAGAACGACGACGAGTACATGC
TGCTCGCGGAGGCGAGGCAGCCGCTGTGGAGGAAGGTGCCGATCCCGTCGAGCAAGATCA
ACCCGTACCGGATCGTGATCGTGCTCCGGCTGGTGGTGCTCTGCTTCTTCCTCAAGTTCC
GGATCACGACGCCGGCGATGGACGCGgtgccgctgtggctggcctcggtgatctgcgagc
tgtggttcgcgctgtcgtggatcctcgaccagctgcccaagtggtcgccggtgacgaggg
agacgtacctggaccggctggccctccggtacgagcgcgacggcgagccgtgccgcctgg
ccccgatcgatttcttcgtcagcacggtggacccgctcaaggagccgcccatcatcaccg
ccaacaccgtgctgtccatcctcgccgtcgactaccccgtcgaccgcgtctcctgctacg
tctccgacgacggcgcgtccatgctgctcttcgacacgctctccgagaccgccgagttcg
cccgccggtgggtccccttctgcaagaagttcaccatcgagccccgcgcccccgagttct
acttctcccagaagatcgactacctcaaggacaaggtccagCCCACCTTCGTCAAAGAAC
GCCGCGCCATGAAGAGAGAGTATGAGGAGTTCAAGGTGAGGATAAACGCGCTGGTGGCGA
AGGCGCAGAAGAAGCCGGAGGAAGGGTGGGTGATGCAGGACGGGACGCCATGGCCGGGGA
ACAACACGAGGGACCACCCGGGGATGATCCAGGTGTACCTGGGCAGCCAGGGCGCGCTCG
ACGTCGAGGGCAGCGAGCTGCCGCGGCtggtgtacgtgtcccgcgagaagcggcccggct
acaaccaccacaagaaggccggcgccatgaactccctcgttcgcgtctccgccgtgctta
ccaacgcccccttcatcctcaacctcgactgcgaccactacgtcaacaacagcaaggccg
tccgcgaggccatgtgcttcctcatggacaagcagctcggcaagaagctgtgctacgtcc
agttcccccagcgcttcgacggcatcgaccgccacgatcgctacgccaaccgcaacaccg
tcttcttcgacATCAACATGAAGGGGCTGGACGGGATACAGGGGCCGGTGTACGTGGGGA
CGGGGACGGTGTTCAACAGGCAGGCGCTGTACGGATACGACCCGCCGCGGCCGGAGAAGA
GGCCGAAGATGACGTGCGACTGCTGGCCGTCGTGGTGCTGCTGCTGCTGCTGCTTCGGCG
GGGGGAAGCGCGGCAAGTCGCACAAGAACAAGAAGGGCGGCGGCGGCGGCGAGGGCGGCG
GCCTCGACGAGCCGCGCCGCGGGCTGCTCGGGTTCTACAAGAAGAGGAGCAAGAAGGACA
AGCTCGGCGGCGGCGCGGCGTCGCTCGCCGGAGGGAAGAAAGGGTACCGGAAGCACCAGC
GCGGGTTCGAGCTGGAGGAGATCGAGGAGGGCCTCGAGGGGTACGACGAGCTGGAGCGCT
CGTCGCTCATGTCGCAGAAGAGCTTCGAGAAGCGGTTCGGCCAGTCGCCGGTGTTCATCG
CCTCCACCCTCGTCGAGGACGGCGGCCTCCCCCAGGGCGCCGCCGCCGACCCCGCCGCCC
TCATCAAGGAGGCCATCCACGTCATCAGCTGCGGCTACGAGGAGAAGACCGAGTGGGGCA
AGGAGAttgggtggatctacgggtcggtgacggaggacatcttaacggggttcaagatgc
attgccgtgggtggaagtcggtgtactgcacgccggcgagggcggcattcaaggggtcgg
cgcccatcaacctgtcggatcgtctgcaccaggtgctccggtgggcgctcggctccgtcg
agatcttcatgagccgccattgcccgctctggtacgcctatggcggccgcctcaagtggc
tcgagcgcttcgcctacaccaacaccatcgtctaccccttcacctccattcccctcctcg
cctactgcaccatccccgccgtctgcctcctcaccggcaagttcatcatccccacgctta
acaatttggcgagcatatggttcatagcgcttttcctgtcgatcatcgcgacgggggtgc
tggagctgcggtggagcggggtgagcatcgaggactggtggaggaacgagcagttctggg
tgatcggcggcgtgtcggcgcacctgttcgccgtgttccagggcctcctcaaggtgctcg
gcggcgtggacaccaacttcacggtgacgtccaaggccgccgccgacgagaccgacgcgt
tcggcgagctctacctgttcaagtggacgacgctgctggtgccgccgacgacgctgatca
tcatcaacatggtggggatcgtcgccggcgtgtcggacgccgtgaacaacgggtacgggt
cgtggggcccgctgttcgggaagctcttcttctccttctgggtcatcctccacctctacc
ccttcctcaaggggctcatggggaggcagaaccggacgcccaccattgtcgtgctctggt
ccatcctcctcgcctccatcttctccctcgtctgggtcaggatcgacccCTTCATCCCCA
AGCCCAAGGGCCCCGTCCTCAAGCCATGCGGGGTCTCGTGCTGAGCTGCTGCTGCTACTT
CTCTGTGTCTCTGCATTTTGCAAGAGGGATGACCGGATGGATGATTCTTGTTGTATGGAG
TATTTTGACTTGTTCATGTACAAGTTTTTGTGAGTGGGATAAAAGTGTTTTGGGGGTAAA
ATTTGTAAGAACTGAGGTGGAGATTATACTCGAATTTAAGAACAATTGTTTTTGAATTTT
CTTTT

CDS

3192 bp

>Os10t0467800-01 Secondary wall-specific cellulose synthase, Secondary cell wall formation
ATGGACACCGCCTCCGTCACCGGTGGCGAGCACAAGGGGAAGGAGAAGACGTGCCGGGTG
TGCGGCGAGGAGGTGGCGGCGAGGGAGGACGGGAAGCCGTTCGTGGCGTGCGCCGAGTGC
GGCTTCCCGGTGTGCAAGCCCTGCTACGAGTACGAGCGCAGCGAGGGCACCCAGTGCTGC
CCCCAGTGCAACACCCGCTACAAGCGCCACAAAGGGTGCCCACGGGTGGAAGGCGACGAG
GACGACGGCGGCGACATGGACGACTTCGAGGAGGAGTTCCAGATCAAGAGCCCCACCAAG
CAGAAACCCCCCCACGAGCCCGTCAACTTCGACGTCTACTCGGAGAACGGCGAGCAGCCG
GCACAGAAGTGGCGCCCTGGAGGCCCGGCGCTCTCTTCCTTCACCGGAAGCGTGGCTGGG
AAGGATCTGGAGCAGGAGAGGGAGATGGAGGGTGGCATGGAGTGGAAGGACAGGATCGAC
AAGTGGAAGACGAAGCAGGAGAAGCGGGGCAAGCTCAACCGCGACGACAGCGACGACGAC
GACGACAAGAACGACGACGAGTACATGCTGCTCGCGGAGGCGAGGCAGCCGCTGTGGAGG
AAGGTGCCGATCCCGTCGAGCAAGATCAACCCGTACCGGATCGTGATCGTGCTCCGGCTG
GTGGTGCTCTGCTTCTTCCTCAAGTTCCGGATCACGACGCCGGCGATGGACGCGgtgccg
ctgtggctggcctcggtgatctgcgagctgtggttcgcgctgtcgtggatcctcgaccag
ctgcccaagtggtcgccggtgacgagggagacgtacctggaccggctggccctccggtac
gagcgcgacggcgagccgtgccgcctggccccgatcgatttcttcgtcagcacggtggac
ccgctcaaggagccgcccatcatcaccgccaacaccgtgctgtccatcctcgccgtcgac
taccccgtcgaccgcgtctcctgctacgtctccgacgacggcgcgtccatgctgctcttc
gacacgctctccgagaccgccgagttcgcccgccggtgggtccccttctgcaagaagttc
accatcgagccccgcgcccccgagttctacttctcccagaagatcgactacctcaaggac
aaggtccagCCCACCTTCGTCAAAGAACGCCGCGCCATGAAGAGAGAGTATGAGGAGTTC
AAGGTGAGGATAAACGCGCTGGTGGCGAAGGCGCAGAAGAAGCCGGAGGAAGGGTGGGTG
ATGCAGGACGGGACGCCATGGCCGGGGAACAACACGAGGGACCACCCGGGGATGATCCAG
GTGTACCTGGGCAGCCAGGGCGCGCTCGACGTCGAGGGCAGCGAGCTGCCGCGGCtggtg
tacgtgtcccgcgagaagcggcccggctacaaccaccacaagaaggccggcgccatgaac
tccctcgttcgcgtctccgccgtgcttaccaacgcccccttcatcctcaacctcgactgc
gaccactacgtcaacaacagcaaggccgtccgcgaggccatgtgcttcctcatggacaag
cagctcggcaagaagctgtgctacgtccagttcccccagcgcttcgacggcatcgaccgc
cacgatcgctacgccaaccgcaacaccgtcttcttcgacATCAACATGAAGGGGCTGGAC
GGGATACAGGGGCCGGTGTACGTGGGGACGGGGACGGTGTTCAACAGGCAGGCGCTGTAC
GGATACGACCCGCCGCGGCCGGAGAAGAGGCCGAAGATGACGTGCGACTGCTGGCCGTCG
TGGTGCTGCTGCTGCTGCTGCTTCGGCGGGGGGAAGCGCGGCAAGTCGCACAAGAACAAG
AAGGGCGGCGGCGGCGGCGAGGGCGGCGGCCTCGACGAGCCGCGCCGCGGGCTGCTCGGG
TTCTACAAGAAGAGGAGCAAGAAGGACAAGCTCGGCGGCGGCGCGGCGTCGCTCGCCGGA
GGGAAGAAAGGGTACCGGAAGCACCAGCGCGGGTTCGAGCTGGAGGAGATCGAGGAGGGC
CTCGAGGGGTACGACGAGCTGGAGCGCTCGTCGCTCATGTCGCAGAAGAGCTTCGAGAAG
CGGTTCGGCCAGTCGCCGGTGTTCATCGCCTCCACCCTCGTCGAGGACGGCGGCCTCCCC
CAGGGCGCCGCCGCCGACCCCGCCGCCCTCATCAAGGAGGCCATCCACGTCATCAGCTGC
GGCTACGAGGAGAAGACCGAGTGGGGCAAGGAGAttgggtggatctacgggtcggtgacg
gaggacatcttaacggggttcaagatgcattgccgtgggtggaagtcggtgtactgcacg
ccggcgagggcggcattcaaggggtcggcgcccatcaacctgtcggatcgtctgcaccag
gtgctccggtgggcgctcggctccgtcgagatcttcatgagccgccattgcccgctctgg
tacgcctatggcggccgcctcaagtggctcgagcgcttcgcctacaccaacaccatcgtc
taccccttcacctccattcccctcctcgcctactgcaccatccccgccgtctgcctcctc
accggcaagttcatcatccccacgcttaacaatttggcgagcatatggttcatagcgctt
ttcctgtcgatcatcgcgacgggggtgctggagctgcggtggagcggggtgagcatcgag
gactggtggaggaacgagcagttctgggtgatcggcggcgtgtcggcgcacctgttcgcc
gtgttccagggcctcctcaaggtgctcggcggcgtggacaccaacttcacggtgacgtcc
aaggccgccgccgacgagaccgacgcgttcggcgagctctacctgttcaagtggacgacg
ctgctggtgccgccgacgacgctgatcatcatcaacatggtggggatcgtcgccggcgtg
tcggacgccgtgaacaacgggtacgggtcgtggggcccgctgttcgggaagctcttcttc
tccttctgggtcatcctccacctctaccccttcctcaaggggctcatggggaggcagaac
cggacgcccaccattgtcgtgctctggtccatcctcctcgcctccatcttctccctcgtc
tgggtcaggatcgacccCTTCATCCCCAAGCCCAAGGGCCCCGTCCTCAAGCCATGCGGG
GTCTCGTGCTGA

Protein

1064 aa

>Os10t0467800-01 Secondary wall-specific cellulose synthase, Secondary cell wall formation
MDTASVTGGEHKGKEKTCRVCGEEVAAREDGKPFVACAECGFPVCKPCYEYERSEGTQCC
PQCNTRYKRHKGCPRVEGDEDDGGDMDDFEEEFQIKSPTKQKPPHEPVNFDVYSENGEQP
AQKWRPGGPALSSFTGSVAGKDLEQEREMEGGMEWKDRIDKWKTKQEKRGKLNRDDSDDD
DDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVLRLVVLCFFLKFRITTPAMDAVP
LWLASVICELWFALSWILDQLPKWSPVTRETYLDRLALRYERDGEPCRLAPIDFFVSTVD
PLKEPPIITANTVLSILAVDYPVDRVSCYVSDDGASMLLFDTLSETAEFARRWVPFCKKF
TIEPRAPEFYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKVRINALVAKAQKKPEEGWV
MQDGTPWPGNNTRDHPGMIQVYLGSQGALDVEGSELPRLVYVSREKRPGYNHHKKAGAMN
SLVRVSAVLTNAPFILNLDCDHYVNNSKAVREAMCFLMDKQLGKKLCYVQFPQRFDGIDR
HDRYANRNTVFFDINMKGLDGIQGPVYVGTGTVFNRQALYGYDPPRPEKRPKMTCDCWPS
WCCCCCCFGGGKRGKSHKNKKGGGGGEGGGLDEPRRGLLGFYKKRSKKDKLGGGAASLAG
GKKGYRKHQRGFELEEIEEGLEGYDELERSSLMSQKSFEKRFGQSPVFIASTLVEDGGLP
QGAAADPAALIKEAIHVISCGYEEKTEWGKEIGWIYGSVTEDILTGFKMHCRGWKSVYCT
PARAAFKGSAPINLSDRLHQVLRWALGSVEIFMSRHCPLWYAYGGRLKWLERFAYTNTIV
YPFTSIPLLAYCTIPAVCLLTGKFIIPTLNNLASIWFIALFLSIIATGVLELRWSGVSIE
DWWRNEQFWVIGGVSAHLFAVFQGLLKVLGGVDTNFTVTSKAAADETDAFGELYLFKWTT
LLVPPTTLIIINMVGIVAGVSDAVNNGYGSWGPLFGKLFFSFWVILHLYPFLKGLMGRQN
RTPTIVVLWSILLASIFSLVWVRIDPFIPKPKGPVLKPCGVSC*

5'UTR

chr10:17262050..17262081 (+ strand) : 32 bp

CDS

chr10:17262082..17262295 (+ strand) : 214 bp

chr10:17262397..17262524 (+ strand) : 128 bp

chr10:17262640..17262709 (+ strand) : 70 bp

chr10:17262797..17262953 (+ strand) : 157 bp

chr10:17263054..17263666 (+ strand) : 613 bp

chr10:17264097..17264573 (+ strand) : 477 bp

chr10:17264651..17265244 (+ strand) : 594 bp

chr10:17265324..17265674 (+ strand) : 351 bp

chr10:17265773..17266360 (+ strand) : 588 bp

3'UTR

chr10:17266361..17266561 (+ strand) : 201 bp

FASTA

>Os10t0467800-01 class=Sequence position=chr10:17262050..17266561 (+ strand)
GCCCACCAAC GTCGCTTCCC CGGCACCTCA CCATGGACAC CGCCTCCGTC ACCGGTGGCG AGCACAAGGG GAAGGAGAAG
ACGTGCCGGG TGTGCGGCGA GGAGGTGGCG GCGAGGGAGG ACGGGAAGCC GTTCGTGGCG TGCGCCGAGT GCGGCTTCCC
GGTGTGCAAG CCCTGCTACG AGTACGAGCG CAGCGAGGGC ACCCAGTGCT GCCCCCAGTG CAACACCCGC TACAAGCGCC
ACAAAGGTAA CATCATGTGT TGTGTCCATG TGATCAATCG CAATTTAGTT CACAAGATCG AGCTTGACAA GAATGTCTGT
CTGTCTGTCT CGATCGATCG GTCGCAGGGT GCCCACGGGT GGAAGGCGAC GAGGACGACG GCGGCGACAT GGACGACTTC
GAGGAGGAGT TCCAGATCAA GAGCCCCACC AAGCAGAAAC CCCCCCACGA GCCCGTCAAC TTCGACGTCT ACTCGGTGAG
AGCTCAACTC GACTCGATCG ATCCATCGCC ATTGATTTCT CACTGCAATT GCTCTGCAAT CAAGTGCTTG TAAACTGATG
CGAAACCTGT ATACAACCTT TGTCTTGCAG GAGAACGGCG AGCAGCCGGC ACAGAAGTGG CGCCCTGGAG GCCCGGCGCT
CTCTTCCTTC ACCGGAAGCG GTCGGTACTC AAATCCCGCA AGAAATTGCG TTTCTTGGTG TAACAATTCA TCTGAAGATG
TGTGTGTGGA TTGCTGTGAA ATTGCAGTGG CTGGGAAGGA TCTGGAGCAG GAGAGGGAGA TGGAGGGTGG CATGGAGTGG
AAGGACAGGA TCGACAAGTG GAAGACGAAG CAGGAGAAGC GGGGCAAGCT CAACCGCGAC GACAGCGACG ACGACGACGA
CAAGAACGAC GACGAGTACA TGCTGTAAGC TTAGCTCTCC AAAGATCTAT CTATCGATCG ACCTCAGATT TTTCAAATCT
TGTGAACTTT GGCATGATCG TGATGATCGA ATTTCTGCAT GCAGGCTCGC GGAGGCGAGG CAGCCGCTGT GGAGGAAGGT
GCCGATCCCG TCGAGCAAGA TCAACCCGTA CCGGATCGTG ATCGTGCTCC GGCTGGTGGT GCTCTGCTTC TTCCTCAAGT
TCCGGATCAC GACGCCGGCG ATGGACGCGg tgccgctgtg gctggcctcg gtgatctgcg agctgtggtt cgcgctgtcg
tggatcctcg accagctgcc caagtggtcg ccggtgacga gggagacgta cctggaccgg ctggccctcc ggtacgagcg
cgacggcgag ccgtgccgcc tggccccgat cgatttcttc gtcagcacgg tggacccgct caaggagccg cccatcatca
ccgccaacac cgtgctgtcc atcctcgccg tcgactaccc cgtcgaccgc gtctcctgct acgtctccga cgacggcgcg
tccatgctgc tcttcgacac gctctccgag accgccgagt tcgcccgccg gtgggtcccc ttctgcaaga agttcaccat
cgagccccgc gcccccgagt tctacttctc ccagaagatc gactacctca aggacaaggt ccagCCCACC TTCGTCAAAG
AACGCCGCGC CATGAAGGTA AACCTTCTCC ACTCCATCTG CGGGTTGAGT GTCGTGGATA TACCGGATTC AAGGGTTTAA
TATATTGTTT TAGGCATTTG TGTTGGGGGG ACCGATATAG CCGGTTATTT CGATCCAAAA TTATTTTATT TTATTTTGAA
AAAAAATGAT TAAAATTTGA ATAAATATTA TCAAATTCAC AAAAATTTGA AAAACATTTA AAAGTTTCGT CCGAAATAAT
ATCATATCAG GTTGTCCAAT AGAACTGAAA TGTCAAAAAT TATGTTATGT AATTTTGAAC CCTCATTCAA TTGGAGCATC
TCGTGATCAG TCTGTTTTTg gagatgtagg ctatggctaa acttcgttac cgatatatcc cttctcgatg ttgtcatcca
gtttagatcg tctataagtt ttTTAACACC TACTCTTGAT GTGACAGAGA GAGTATGAGG AGTTCAAGGT GAGGATAAAC
GCGCTGGTGG CGAAGGCGCA GAAGAAGCCG GAGGAAGGGT GGGTGATGCA GGACGGGACG CCATGGCCGG GGAACAACAC
GAGGGACCAC CCGGGGATGA TCCAGGTGTA CCTGGGCAGC CAGGGCGCGC TCGACGTCGA GGGCAGCGAG CTGCCGCGGC
tggtgtacgt gtcccgcgag aagcggcccg gctacaacca ccacaagaag gccggcgcca tgaactccct cgttcgcgtc
tccgccgtgc ttaccaacgc ccccttcatc ctcaacctcg actgcgacca ctacgtcaac aacagcaagg ccgtccgcga
ggccatgtgc ttcctcatgg acaagcagct cggcaagaag ctgtgctacg tccagttccc ccagcgcttc gacggcatcg
accgccacga tcgctacgcc aaccgcaaca ccgtcttctt cgacgtgagc actgcCTTCT TCTCCGGCGT GCGTGCGTCG
CGCCGTGACG TGAGCTAACG ATGGTGTCGT TTGATGTGCA GATCAACATG AAGGGGCTGG ACGGGATACA GGGGCCGGTG
TACGTGGGGA CGGGGACGGT GTTCAACAGG CAGGCGCTGT ACGGATACGA CCCGCCGCGG CCGGAGAAGA GGCCGAAGAT
GACGTGCGAC TGCTGGCCGT CGTGGTGCTG CTGCTGCTGC TGCTTCGGCG GGGGGAAGCG CGGCAAGTCG CACAAGAACA
AGAAGGGCGG CGGCGGCGGC GAGGGCGGCG GCCTCGACGA GCCGCGCCGC GGGCTGCTCG GGTTCTACAA GAAGAGGAGC
AAGAAGGACA AGCTCGGCGG CGGCGCGGCG TCGCTCGCCG GAGGGAAGAA AGGGTACCGG AAGCACCAGC GCGGGTTCGA
GCTGGAGGAG ATCGAGGAGG GCCTCGAGGG GTACGACGAG CTGGAGCGCT CGTCGCTCAT GTCGCAGAAG AGCTTCGAGA
AGCGGTTCGG CCAGTCGCCG GTGTTCATCG CCTCCACCCT CGTCGAGGAC GGCGGCCTCC CCCAGGGCGC CGCCGCCGAC
CCCGCCGCCC TCATCAAGGA GGCCATCCAC GTCATCAGCT GCGGCTACGA GGAGAAGACC GAGTGGGGCA AGGAGGTAAT
CCATCAAAAA ATCTCCACCA TTTTCAAGCT CGAGGAAGAT GATCGAAGCT AACCAAAAAT CAAAATTCTT GCAGAttggg
tggatctacg ggtcggtgac ggaggacatc ttaacggggt tcaagatgca ttgccgtggg tggaagtcgg tgtactgcac
gccggcgagg gcggcattca aggggtcggc gcccatcaac ctgtcggatc gtctgcacca ggtgctccgg tgggcgctcg
gctccgtcga gatcttcatg agccgccatt gcccgctctg gtacgcctat ggcggccgcc tcaagtggct cgagcgcttc
gcctacacca acaccatcgt ctaccccttc acctccattc ccctcctcgc ctactgcacc atccccgccg tctgcctcct
caccggcaag ttcatcatcc ccacggtaaa gaaccaacca agaacatcaa aatttccgct aaaatttcaa gctccaaatg
atcttgcact gaccgatcga tcgcgatctt ggtgtacgtg tagcttaaca atttggcgag catatggttc atagcgcttt
tcctgtcgat catcgcgacg ggggtgctgg agctgcggtg gagcggggtg agcatcgagg actggtggag gaacgagcag
ttctgggtga tcggcggcgt gtcggcgcac ctgttcgccg tgttccaggg cctcctcaag gtgctcggcg gcgtggacac
caacttcacg gtgacgtcca aggccgccgc cgacgagacc gacgcgttcg gcgagctcta cctgttcaag tggacgacgc
tgctggtgcc gccgacgacg ctgatcatca tcaacatggt ggggatcgtc gccggcgtgt cggacgccgt gaacaacggg
tacgggtcgt ggggcccgct gttcgggaag ctcttcttct ccttctgggt catcctccac ctctacccct tcctcaaggg
gctcatgggg aggcagaacc ggacgcccac cattgtcgtg ctctggtcca tcctcctcgc ctccatcttc tccctcgtct
gggtcaggat cgacccCTTC ATCCCCAAGC CCAAGGGCCC CGTCCTCAAG CCATGCGGGG TCTCGTGCTG AGCTGCTGCT
GCTACTTCTC TGTGTCTCTG CATTTTGCAA GAGGGATGAC CGGATGGATG ATTCTTGTTG TATGGAGTAT TTTGACTTGT
TCATGTACAA GTTTTTGTGA GTGGGATAAA AGTGTTTTGG GGGTAAAATT TGTAAGAACT GAGGTGGAGA TTATACTCGA
ATTTAAGAAC AATTGTTTTT GAATTTTCTT TT

Locus: Os10g0467800

Loading...

Locus: Os10g0467800

Loading...