Os10t0471100-01

Locus

Os10g0471100

Description

Protein with high similarity to proteins involved in wax production, Cuticular wax biosynthesis

RAP-DB Gene Symbol Synonym(s)

WDA1, Wda1, wda1, OS-CER1, OsGL1-5

RAP-DB Gene Name Synonym(s)

WAX-DEFICIENT ANTHER 1, Wax-deficient anther1, Wax-deficient anther 1, WDA1 protein, Glossy1-homologous gene 5

CGSNL Gene Symbol

WDA1

CGSNL Gene Name

WAX-DEFICIENT ANTHER 1

Oryzabase Gene Symbol Synonym(s)

OsWDA1, Wda1, wda1, OS-CER1, OsGL1-5

Oryzabase Gene Name Synonym(s)

Wax-deficient anther1, Wax-deficient anther 1, WDA1 protein, Glossy1-homologous gene 5

Transcript Evidence

AK100751 (Genbank)

Protein Evidence

Q9FWK6 (UniProt)

Q7XDI3 (UniProt)

Literature

PMID: 17138699

Note

Manual Curation

August 4, 2009

Gene Ontology (GO)

Biological Process: fatty acid biosynthetic process (GO:0006633)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Fatty acid hydroxylase (IPR006694)

Uncharacterised domain Wax2, C-terminal (IPR021940)

Full-length cDNA

J023118L15 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0471100-01)

RiceXPro (AK100751)

Others

Oryzabase (7492)

KEGG (Os10t0471100-01)

Transcript

2336 bp

>Os10t0471100-01 Protein with high similarity to proteins involved in wax production, Cuticular wax biosynthesis
ATATGAGACTCTGACACGTACGCACAGCTAGATCGAAGCCCTGGTCGAGTTTATAAATTG
AGATATATCCGTCCTCCATTCTCAGGCCAGTTCTTGCAAGACTCTTGCCGTGTTGAGACT
GCAGAAACGAGAGCTAGCTAGCCAGAGGCTGCAAGAAGATTCTGCACCCATAGATCGTCT
ACCATGGCCACAAACCCAGGACTCTTCACGGAGTGGCCATGGAAGAAGCTTGGCAGCTTC
AAGTACGTGTTGCTGGCGCCGTGGGTAGCGCACGGGTGGTATGAGGTGGCGACCAAGGGG
TGGCGGGAGGTGGATCTCGGGTACATCGCCATCCTCCCGTCGTTGCTGCTGCGGATGCTG
CACAACCAAGCCTGGATCACCATCTCCCGCCTCCAAAACGCCCGTGGCCGCCGCCAGATT
GTTCGCCGCGGCATCGAGTTCGACCAGGTTGACCGCGAGAGGAACTGGGACGACCAGATC
ATCCTGAGCGGTATCCTACTATACCTCGGCGCACTGTACGTACCGGGCGGGCAACACTTA
CCGCTGTGGAGGACGGATGGCGCGGGGCTGATCGCCTTGCTGCATGCGGGGCCAGTGGAG
TTCCTCTACTACTGGTTCCATCGTGCGTTGCACCACCACTTTCTCTACACCCACTACCAC
TCGCACCACCACTCTTCAATCGTCACTGAGCCCATCACATCCGTCATCCATCCGTTTGCT
GAGCTCGTTGCCTACGAATTGCTCTTCTCGATCCCACTGATCGCCTGTGCCTTGACTGGA
ACTGCTTCCATAATTGCATTCGAGATGTATTTGATTTACATTGATTTCATGAACAACATG
GGGCACTGCAACTTCGAGTTGGTACCCAGCTGGCTCTTCACATGGTTCCCTCCTCTCAAG
TATCTCATGTACACGCCATCGTTTCATTCTCTGCACCACACTCAGTTTCGGACAAACTAC
TCCCTTTTCATGCCGTTCTACGATTATATCTACAACACCATGGACAAGTCATCAGACACT
CTGTATGAGAACTCACTGAAAAACAATGAGGAAGAAGAAGCAGTGGATGTGGTTCACCTT
ACACACCTGACCACCCTGCATTCCATCTACCACATGAGGCCCGGTTTCGCCGAATTTGCG
TCCAGGCCCTACGTTTCCAGGTGGTACATGAGGATGATGTGGCCTCTGTCATGGCTCTCC
ATGGTGCTGACATGGACGTACGGTTCTTCATTCACTGTTGAGAGGAATGTCATGAAGAAG
ATCAGGATGCAGTCATGGGCCATACCAAGATACAGTTTCCATTATGGATTGGATTGGGAG
AAGGAAGCTATCAATGATCTTATCGAAAAGGCGGTATGTGAAGCTGACAAGAATGGGGCT
AAAGTTGTAAGCCTTGGACTCCTGAATCAGGCACATACCCTGAATAAAAGTGGAGAACAA
TATCTGCTGAAATACCCAAAGTTGGGAGCAAGAATTGTCGATGGAACCAGCTTAGCTGCT
GCAGTGGTTGTCAACAGTATCCCCCAAGGCACAGACCAAGTAATTCTTGCAGGAAATGTT
TCCAAGGTGGCGCGTGCTGTAGCGCAAGCATTATGCAAGAAAAATATCAAAGTCACGATG
ACAAACAAGCAAGATTATCATTTACTCAAGCCAGAAATACCAGAAACTGTAGCTGACAAT
CTTTCGTTTTCGAAAACAGGCACCGCAAAGGTTTGGTTAATTGGTGATGGTCTAGATTCT
GCTGAACAATTCAGAGCACAGAAAGGAACTCTGTTTATCCCATACTCACAATTTCCTCCA
AAGATGGTACGCAAGGACAGCTGCAGCTACTCGACAACTCCTGCAATGGCTGTACCAAAA
ACGCTGCAGAATGTGCATTCATGCGAGAATTGGCTGCCAAGGAGGGTTATGAGCGCATGG
CGAATCGCGGGAATTCTTCATGCGTTGGAGGGATGGAATGAGCATGAATGTGGTGACAAG
GTGCTTGATATGGACAAAGTTTGGTCTGCTGCAATTATGCATGGGTTCTGCCCAGTTGCT
CAAGGTTGATGATTCAGTTGCAAAGTATCAGAATAAGTTTTAGCTGGATTATGCTATGTG
GTCACCGTATCAGAAAGAGAGATGTTCTGTTGGCAAGAAGAGATATAGTATCTGAGTAAT
TTCATCTGCCATGGTTTTTAAAACATTGTTCATCATCTCCTTTGATCAAAGACTGGCCAT
GGCTACTTTCTGTATAAGTATCTGTCCTTTTTAGTCCATAGTGTAATTCAGCAACAAAAC
ACTCTTGGCATTGTTATGCAGTCTCATGAATGTTTTTCCAGCATACGGAATTACGG

CDS

1866 bp

>Os10t0471100-01 Protein with high similarity to proteins involved in wax production, Cuticular wax biosynthesis
ATGGCCACAAACCCAGGACTCTTCACGGAGTGGCCATGGAAGAAGCTTGGCAGCTTCAAG
TACGTGTTGCTGGCGCCGTGGGTAGCGCACGGGTGGTATGAGGTGGCGACCAAGGGGTGG
CGGGAGGTGGATCTCGGGTACATCGCCATCCTCCCGTCGTTGCTGCTGCGGATGCTGCAC
AACCAAGCCTGGATCACCATCTCCCGCCTCCAAAACGCCCGTGGCCGCCGCCAGATTGTT
CGCCGCGGCATCGAGTTCGACCAGGTTGACCGCGAGAGGAACTGGGACGACCAGATCATC
CTGAGCGGTATCCTACTATACCTCGGCGCACTGTACGTACCGGGCGGGCAACACTTACCG
CTGTGGAGGACGGATGGCGCGGGGCTGATCGCCTTGCTGCATGCGGGGCCAGTGGAGTTC
CTCTACTACTGGTTCCATCGTGCGTTGCACCACCACTTTCTCTACACCCACTACCACTCG
CACCACCACTCTTCAATCGTCACTGAGCCCATCACATCCGTCATCCATCCGTTTGCTGAG
CTCGTTGCCTACGAATTGCTCTTCTCGATCCCACTGATCGCCTGTGCCTTGACTGGAACT
GCTTCCATAATTGCATTCGAGATGTATTTGATTTACATTGATTTCATGAACAACATGGGG
CACTGCAACTTCGAGTTGGTACCCAGCTGGCTCTTCACATGGTTCCCTCCTCTCAAGTAT
CTCATGTACACGCCATCGTTTCATTCTCTGCACCACACTCAGTTTCGGACAAACTACTCC
CTTTTCATGCCGTTCTACGATTATATCTACAACACCATGGACAAGTCATCAGACACTCTG
TATGAGAACTCACTGAAAAACAATGAGGAAGAAGAAGCAGTGGATGTGGTTCACCTTACA
CACCTGACCACCCTGCATTCCATCTACCACATGAGGCCCGGTTTCGCCGAATTTGCGTCC
AGGCCCTACGTTTCCAGGTGGTACATGAGGATGATGTGGCCTCTGTCATGGCTCTCCATG
GTGCTGACATGGACGTACGGTTCTTCATTCACTGTTGAGAGGAATGTCATGAAGAAGATC
AGGATGCAGTCATGGGCCATACCAAGATACAGTTTCCATTATGGATTGGATTGGGAGAAG
GAAGCTATCAATGATCTTATCGAAAAGGCGGTATGTGAAGCTGACAAGAATGGGGCTAAA
GTTGTAAGCCTTGGACTCCTGAATCAGGCACATACCCTGAATAAAAGTGGAGAACAATAT
CTGCTGAAATACCCAAAGTTGGGAGCAAGAATTGTCGATGGAACCAGCTTAGCTGCTGCA
GTGGTTGTCAACAGTATCCCCCAAGGCACAGACCAAGTAATTCTTGCAGGAAATGTTTCC
AAGGTGGCGCGTGCTGTAGCGCAAGCATTATGCAAGAAAAATATCAAAGTCACGATGACA
AACAAGCAAGATTATCATTTACTCAAGCCAGAAATACCAGAAACTGTAGCTGACAATCTT
TCGTTTTCGAAAACAGGCACCGCAAAGGTTTGGTTAATTGGTGATGGTCTAGATTCTGCT
GAACAATTCAGAGCACAGAAAGGAACTCTGTTTATCCCATACTCACAATTTCCTCCAAAG
ATGGTACGCAAGGACAGCTGCAGCTACTCGACAACTCCTGCAATGGCTGTACCAAAAACG
CTGCAGAATGTGCATTCATGCGAGAATTGGCTGCCAAGGAGGGTTATGAGCGCATGGCGA
ATCGCGGGAATTCTTCATGCGTTGGAGGGATGGAATGAGCATGAATGTGGTGACAAGGTG
CTTGATATGGACAAAGTTTGGTCTGCTGCAATTATGCATGGGTTCTGCCCAGTTGCTCAA
GGTTGA

Protein

622 aa

>Os10t0471100-01 Protein with high similarity to proteins involved in wax production, Cuticular wax biosynthesis
MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH
NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP
LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITSVIHPFAE
LVAYELLFSIPLIACALTGTASIIAFEMYLIYIDFMNNMGHCNFELVPSWLFTWFPPLKY
LMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDTLYENSLKNNEEEEAVDVVHLT
HLTTLHSIYHMRPGFAEFASRPYVSRWYMRMMWPLSWLSMVLTWTYGSSFTVERNVMKKI
RMQSWAIPRYSFHYGLDWEKEAINDLIEKAVCEADKNGAKVVSLGLLNQAHTLNKSGEQY
LLKYPKLGARIVDGTSLAAAVVVNSIPQGTDQVILAGNVSKVARAVAQALCKKNIKVTMT
NKQDYHLLKPEIPETVADNLSFSKTGTAKVWLIGDGLDSAEQFRAQKGTLFIPYSQFPPK
MVRKDSCSYSTTPAMAVPKTLQNVHSCENWLPRRVMSAWRIAGILHALEGWNEHECGDKV
LDMDKVWSAAIMHGFCPVAQG*

5'UTR

chr10:17454673..17454855 (- strand) : 183 bp

CDS

chr10:17454613..17454672 (- strand) : 60 bp

chr10:17453925..17454148 (- strand) : 224 bp

chr10:17453560..17453792 (- strand) : 233 bp

chr10:17451658..17451877 (- strand) : 220 bp

chr10:17450714..17451095 (- strand) : 382 bp

chr10:17450519..17450626 (- strand) : 108 bp

chr10:17449990..17450190 (- strand) : 201 bp

chr10:17449807..17449905 (- strand) : 99 bp

chr10:17449534..17449710 (- strand) : 177 bp

chr10:17449282..17449443 (- strand) : 162 bp

3'UTR

chr10:17448995..17449281 (- strand) : 287 bp

FASTA

>Os10t0471100-01 class=Sequence position=chr10:17448995..17454855 (- strand)
ATATGAGACT CTGACACGTA CGCACAGCTA GATCGAAGCC CTGGTCGAGT TTATAAATTG AGATATATCC GTCCTCCATT
CTCAGGCCAG TTCTTGCAAG ACTCTTGCCG TGTTGAGACT GCAGAAACGA GAGCTAGCTA GCCAGAGGCT GCAAGAAGAT
TCTGCACCCA TAGATCGTCT ACCATGGCCA CAAACCCAGG ACTCTTCACG GAGTGGCCAT GGAAGAAGCT TGGCAGCTTC
AAGGTAATCA AAATTAACCT TCCATCTTCT TCTCCTTAAT TCAGTTACTT CACTGTCTTC TGGCAGCTCG ATCGAGCAAA
TAAACGCACA GCTTCTAGTT CCATCCATGG CAGCACTGCA CCATGACCAT TATGTTCTTG TTTGAGTTCG CTAGCTTCTG
TTTGATATCA AAGCATACAT TGCCGCATGT GCAGCTAGCA GTGCATGAGA TTAATTCTCT TGCATCTGCT GCAGATCAGT
AATGCAGGGG CATGAACTTT CCTGCAGCAC CTCTGTGCAG CAAATAAACT GTTAAAGAGT ACATGGTTAA ATAAGCTTTT
GCCACATCGT CTTTGATTAG GCAAAAACAT TCAGTATACA CAACTTCCGA CCTTTACAAA TTACAACAGT AACTTCAGCT
ATAAATTATA GCACATGTGA GTTAATTCGA TGGATGGATT CATGCATGTA TATGTGTGCA TATGCAGTAC GTGTTGCTGG
CGCCGTGGGT AGCGCACGGG TGGTATGAGG TGGCGACCAA GGGGTGGCGG GAGGTGGATC TCGGGTACAT CGCCATCCTC
CCGTCGTTGC TGCTGCGGAT GCTGCACAAC CAAGCCTGGA TCACCATCTC CCGCCTCCAA AACGCCCGTG GCCGCCGCCA
GATTGTTCGC CGCGGCATCG AGTTCGACCA GGTTGACCGC GAGAGGAACT GGTATGCCAA ACACCATAAA ATTACGTACA
ACCCACGCGG TGTGTTCGTG GCGGCTAGCT TCACCTTCGA GATTAATTAA TTCAACCTCA TTATAGTTGA TGTGTTGTTA
CGTGTATGGT GGTGTGCGTG CAGGGACGAC CAGATCATCC TGAGCGGTAT CCTACTATAC CTCGGCGCAC TGTACGTACC
GGGCGGGCAA CACTTACCGC TGTGGAGGAC GGATGGCGCG GGGCTGATCG CCTTGCTGCA TGCGGGGCCA GTGGAGTTCC
TCTACTACTG GTTCCATCGT GCGTTGCACC ACCACTTTCT CTACACCCAC TACCACTCGC ACCACCACTC TTCAATCGTC
ACTGAGCCCA TCACATGTAC GTAATTAATT GCCACTAGAG ACGGTTTATC CTCGAGGCTC CAAACATTAC ATTCTCTTTT
AGGCAATAAC CTTTGAGCTT CTATATTAGT ATCGAATTGT GTTGCGTCAt aaatattttt acaaaatttt tattcatcat
ctaaagttat caatgatcaa agttcaatca atactaatag ttacaagtaa tttgaaatag aggaagtaAG TTGTACTACC
TAGTTGTACC ATCATTGCTC CAAACAACCT ATTACATGAT ATTACTTTCG TCCCAAACCT CTAAATGAAT ATTAAGATTT
TGGTAATACA AATTCTTAAA ATTTTGAGAC AGAAATATTA CTAGACCTGT AACCTTGGGA TAAATTAAAC CACGGTAATC
TTCCAATAGA ACAAAGTAAA AAACAAGTCT TTTCCATAAG GACACAAAAC AGGAGGTGTA CTTCGTCAGA TGCAAGTGTC
GCGCGTGTCC GTTCCTCAGG AAACACAGAG TGTTCCTGTG GCCAGTCGAT CGCTACTTCA ATTCCCTCCT CCTTCAATGC
ATGCCTGAAC AATAATTGTA GGCCTAGAGA GTGTGTGAGT TAAGGAATGC AAAGGACACA CGATATTTCA TGGACCATTG
AGATCGAAGT AAGCCGACCG ATCGATCGCG AGCTAAATTT ATGTAGCCCA TCGAATCCGT TGCTGAATGC CTGACCAAAC
GGAGAAGCAA ACGTGGTCCA TGAACAACGT ATCAGAGACT TTTAGACAAG AGAGAAATCA CATTCTAAGG GGTTTTTTCC
CCCTTTTTTT TGAGTGGAAG AGTTTTTTTT ATTGAGAGGT ATCGAGAAGT ACTATATTTT TCGTGTAAGC TAGCCAAATA
TCAGTGCGTT GCAACTTGCA ACGGATTATT AAAAATAGCA AAATTAAGTC CTTGTTAAAT TTTTTTTAAA AAAAAATGGT
TGAAACACAA CTTTTCATCT TAAAGAAACA AACAAAAATG CCATGCTTAG AAAATTAAAG AGCTAAAGTA TAGTACAGTA
TATATAGTAC AGGCGACTCT CCCAAACCTT AATACCATGG CCCATATATC AGTGACCCAG GCCCTGGGCA AACTGGTCCA
CGGCCCAGGG CCTGAGATGA AAGGCCCGAT GAGAAATATG CATTTTTACT AGGAATAAGT CTATTTTTCC TCCTTTCAAC
CATGTAACTT TGTGTTGGGC CAAAATTTCC ATGGGGCGGC CTAGGCCTTG GCCTATTTCT GGGTCCGCCC CTTATCAGTG
ATTGTGGTGA TGGCAGATTC ACTACCACCA CTACTATCTT TTAATAGTAG TAAAGATTTT GGTGTCATCT TGTAATTTTA
AGATGTACAA GACGGTACCA TAAATTGACT TTAAAGTGAT TTGAATGGAT GTGTAATGGG AGAAATCGCT TTTCAAATGT
AAAATAATGC ACTACTTGTA TTAGTACTAA ATTTTACATT AGAGAACACG ATATATTCAG TGATTCTTGA TAACCATAAA
ATCCCTTTAA GATTATGGTG TTTTCTTTAA GTACTGTTAA AAAAAAACCA ATAGTGTCTA CTGGTTACAC TGCAGAAGAA
GAGAACCCTG CAGACTGCAG TATTTGTAAT TGAGCAAGCA GATACATATA CCTAAATGCA TATATGTTCA TTACCTACAA
TTCCTAACGT TGTTGCAGCC GTCATCCATC CGTTTGCTGA GCTCGTTGCC TACGAATTGC TCTTCTCGAT CCCACTGATC
GCCTGTGCCT TGACTGGAAC TGCTTCCATA ATTGCATTCG AGATGTATTT GATTTACATT GATTTCATGA ACAACATGGG
GCACTGCAAC TTCGAGTTGG TACCCAGCTG GCTCTTCACA TGGTTCCCTC CTCTCAAGTA TCTCATGTAC ACGCCATCGT
AAGTACTTCA TCAGGCTCTT AATAAtactt ccttcttcct taaatgtttg acgccgttga cttttttaaa catgtttgac
cgttcgtctt attcaaaaac ttttgtgaaa tgtgtaaaac tatatgtata cataaaagta tatttaacaa taaatcaaat
gatagaaaaa gaattaataa ttatttaaat ttttgaataa gacgaacggt caaatatttt taaaaaagtc aatggcatca
aatattttgg gatggaggga gtaTGTAAAA GAGTAACTTT ACAGTTTTTA AGAAAGCATA GGGGAAGTAC CATATTTTAT
ATTGGAGAAA TTTTACGGTT TTCAGTATTT CTTTTAAGAT AAAGGAGGCT TTATTGATCT TGGATACAAT ATACTCTAAA
ACCACTCCTG ATATCTGCAT AGCTAGGATG CACATGGTCT ATAGTTATTG AAAAAGCCAA ATAAAAGAAG ATGATGTGCA
TGTCACTCTG CAAAATAAAT AACTTGATCA TACATGCTGT TTTCACTGTT ATAATAATCT GAACTTATGT GATATATTAG
GTTTCATTCT CTGCACCACA CTCAGTTTCG GACAAACTAC TCCCTTTTCA TGCCGTTCTA CGATTATATC TACAACACCA
TGGACAAGTC ATCAGACACT CTGTATGAGA ACTCACTGAA AAACAATGAG GAAGAAGAAG CAGTGGATGT GGTTCACCTT
ACACACCTGA CCACCCTGCA TTCCATCTAC CACATGAGGC CCGGTTTCGC CGAATTTGCG TCCAGGCCCT ACGTTTCCAG
GTGGTACATG AGGATGATGT GGCCTCTGTC ATGGCTCTCC ATGGTGCTGA CATGGACGTA CGGTTCTTCA TTCACTGTTG
AGAGGAATGT CATGAAGAAG ATCAGGATGC AGTCATGGGC CATACCAAGA TACAGTTTCC ATGTAAGAGT AACCATGTTC
AGTGCATGAT TCACAGATGG TGTGCATGAT AAATTGATAA TCAGGTTAGA AACATTTTGT TTTGTGCAGT ATGGATTGGA
TTGGGAGAAG GAAGCTATCA ATGATCTTAT CGAAAAGGCG GTATGTGAAG CTGACAAGAA TGGGGCTAAA GTTGTAAGCC
TTGGACTCCT GAATCAGGTA GCTCATTTCC TAATGAATTC AGAGCAAGTT GAAACATTAT CATCCATACT TCAGAATTCA
GATGTTAGCT ATATGTCCAC ATGTACTGCC AAATTTTAGT CAAGATAAAA CAGTTAGTGC TTAATAATTG TTTATCTTCA
GGGAAAAGGT TTAGTCATAA AGGTAGGAAA ATAAAAAAAT TAAGTAGCAA AGAGTCCGTT GACAGTAGTC CAACAGAACT
AATAAATTCT GTACATTTCA TGAGAATACA ATATGTAGAA ATTAGGGAAG TATGTACTCA TGCATGGTTG AACTGGTAAT
TGACATACAA TATCTTCAAT ATAAGGCACA TACCCTGAAT AAAAGTGGAG AACAATATCT GCTGAAATAC CCAAAGTTGG
GAGCAAGAAT TGTCGATGGA ACCAGCTTAG CTGCTGCAGT GGTTGTCAAC AGTATCCCCC AAGGCACAGA CCAAGTAATT
CTTGCAGGAA ATGTTTCCAA GGTGGCGCGT GCTGTAGCGC AAGCATTATG CAAGAAAAAT ATCAAAGTAA TTAATCCACT
ACTCACCTCT GATTTATTTT ATAGCATGCA AAAGGATACC ATGTTGTAAC AAACCACTAT TCTTGTACAG GTCACGATGA
CAAACAAGCA AGATTATCAT TTACTCAAGC CAGAAATACC AGAAACTGTA GCTGACAATC TTTCGTTTTC GAAAACAGGC
ACCGCAAAGG TAAGAATAGA TTTCCTCATT TTTCCTACAT TCTCTGGACA AATGAATAGA ATGTATAAGA GAAATATCAT
TGCCTAATAA ACCAAAAATT TTCAGGTTTG GTTAATTGGT GATGGTCTAG ATTCTGCTGA ACAATTCAGA GCACAGAAAG
GAACTCTGTT TATCCCATAC TCACAATTTC CTCCAAAGAT GGTACGCAAG GACAGCTGCA GCTACTCGAC AACTCCTGCA
ATGGCTGTAC CAAAAACGCT GCAGAATGTG CATTCATGCG AGGTAGTAGT AATAACCTGT TGAAATAATC CAGAGATTCA
GACGAACTTC ACATGATCTA ATCACAAAAT TTTTGAACTT TTTTTTTGAC AGAATTGGCT GCCAAGGAGG GTTATGAGCG
CATGGCGAAT CGCGGGAATT CTTCATGCGT TGGAGGGATG GAATGAGCAT GAATGTGGTG ACAAGGTGCT TGATATGGAC
AAAGTTTGGT CTGCTGCAAT TATGCATGGG TTCTGCCCAG TTGCTCAAGG TTGATGATTC AGTTGCAAAG TATCAGAATA
AGTTTTAGCT GGATTATGCT ATGTGGTCAC CGTATCAGAA AGAGAGATGT TCTGTTGGCA AGAAGAGATA TAGTATCTGA
GTAATTTCAT CTGCCATGGT TTTTAAAACA TTGTTCATCA TCTCCTTTGA TCAAAGACTG GCCATGGCTA CTTTCTGTAT
AAGTATCTGT CCTTTTTAGT CCATAGTGTA ATTCAGCAAC AAAACACTCT TGGCATTGTT ATGCAGTCTC ATGAATGTTT
TTCCAGCATA CGGAATTACG G

Locus: Os10g0471100

Loading...

Locus: Os10g0471100

Loading...