Os10t0471100-02

Locus

Os10g0471100

Description

Similar to CER1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WDA1

CGSNL Gene Name

WAX-DEFICIENT ANTHER 1

Oryzabase Gene Symbol Synonym(s)

OsWDA1, Wda1, wda1, OS-CER1, OsGL1-5

Oryzabase Gene Name Synonym(s)

Wax-deficient anther1, Wax-deficient anther 1, WDA1 protein, Glossy1-homologous gene 5

Transcript Evidence

AK121097 (DDBJ, Best hit)

Protein Evidence

Q9XH51 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023068L20 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0471100-02)

RiceXPro (AK121097)

Others

Oryzabase (7492)

KEGG (Os10t0471100-02)

Transcript

783 bp

>Os10t0471100-02 Similar to CER1.
AGTTCTTGCAAGACTCTTGCCGTGTTGAGACTGCAGAAACGAGAGCTAGCTAGCCAGAGG
CTGCAAGAAGATTCTGCACCCATAGATCGTCTACCATGGCCACAAACCCAGGACTCTTCA
CGGAGTGGCCATGGAAGAAGCTTGGCAGCTTCAAGTACGTGTTGCTGGCGCCGTGGGTAG
CGCACGGGTGGTATGAGGTGGCGACCAAGGGGTGGCGGGAGGTGGATCTCGGGTACATCG
CCATCCTCCCGTCGTTGCTGCTGCGGATGCTGCACAACCAAGCCTGGATCACCATCTCCC
GCCTCCAAAACGCCCGTGGCCGCCGCCAGATTGTTCGCCGCGGCATCGAGTTCGACCAGG
TTGACCGCGAGAGGAACTGGGACGACCAGATCATCCTGAGCGGTATCCTACTATACCTCG
GCGCACTGTACGTACCGGGCGGGCAACACTTACCGCTGTGGAGGACGGATGGCGCGGGGC
TGATCGCCTTGCTGCATGCGGGGCCAGTGGAGTTCCTCTACTACTGGTTCCATCGTGCGT
TGCACCACCACTTTCTCTACACCCACTACCACTCGCACCACCACTCTTCAATCGTCACTG
AGCCCATCACATGTACGTAATTAATTGCCACTAGAGACGGTTTATCCTCGAGGCTCCAAA
CATTACATTCTCTTTTAGGCAATAACCTTTGAGCTTCTATATTAGTATCGAATTGTGTTG
CGTCAtaaatatttttacaaaatttttattcatcatctaaagttatcaatgatcaaagtt
caa

CDS

525 bp

>Os10t0471100-02 Similar to CER1.
ATGGCCACAAACCCAGGACTCTTCACGGAGTGGCCATGGAAGAAGCTTGGCAGCTTCAAG
TACGTGTTGCTGGCGCCGTGGGTAGCGCACGGGTGGTATGAGGTGGCGACCAAGGGGTGG
CGGGAGGTGGATCTCGGGTACATCGCCATCCTCCCGTCGTTGCTGCTGCGGATGCTGCAC
AACCAAGCCTGGATCACCATCTCCCGCCTCCAAAACGCCCGTGGCCGCCGCCAGATTGTT
CGCCGCGGCATCGAGTTCGACCAGGTTGACCGCGAGAGGAACTGGGACGACCAGATCATC
CTGAGCGGTATCCTACTATACCTCGGCGCACTGTACGTACCGGGCGGGCAACACTTACCG
CTGTGGAGGACGGATGGCGCGGGGCTGATCGCCTTGCTGCATGCGGGGCCAGTGGAGTTC
CTCTACTACTGGTTCCATCGTGCGTTGCACCACCACTTTCTCTACACCCACTACCACTCG
CACCACCACTCTTCAATCGTCACTGAGCCCATCACATGTACGTAA

Protein

175 aa

>Os10t0471100-02 Similar to CER1.
MATNPGLFTEWPWKKLGSFKYVLLAPWVAHGWYEVATKGWREVDLGYIAILPSLLLRMLH
NQAWITISRLQNARGRRQIVRRGIEFDQVDRERNWDDQIILSGILLYLGALYVPGGQHLP
LWRTDGAGLIALLHAGPVEFLYYWFHRALHHHFLYTHYHSHHHSSIVTEPITCT*

5'UTR

chr10:17454673..17454767 (- strand) : 95 bp

CDS

chr10:17454613..17454672 (- strand) : 60 bp

chr10:17453925..17454148 (- strand) : 224 bp

chr10:17453552..17453792 (- strand) : 241 bp

3'UTR

chr10:17453389..17453551 (- strand) : 163 bp

FASTA

>Os10t0471100-02 class=Sequence position=chr10:17453389..17454767 (- strand)
AGTTCTTGCA AGACTCTTGC CGTGTTGAGA CTGCAGAAAC GAGAGCTAGC TAGCCAGAGG CTGCAAGAAG ATTCTGCACC
CATAGATCGT CTACCATGGC CACAAACCCA GGACTCTTCA CGGAGTGGCC ATGGAAGAAG CTTGGCAGCT TCAAGGTAAT
CAAAATTAAC CTTCCATCTT CTTCTCCTTA ATTCAGTTAC TTCACTGTCT TCTGGCAGCT CGATCGAGCA AATAAACGCA
CAGCTTCTAG TTCCATCCAT GGCAGCACTG CACCATGACC ATTATGTTCT TGTTTGAGTT CGCTAGCTTC TGTTTGATAT
CAAAGCATAC ATTGCCGCAT GTGCAGCTAG CAGTGCATGA GATTAATTCT CTTGCATCTG CTGCAGATCA GTAATGCAGG
GGCATGAACT TTCCTGCAGC ACCTCTGTGC AGCAAATAAA CTGTTAAAGA GTACATGGTT AAATAAGCTT TTGCCACATC
GTCTTTGATT AGGCAAAAAC ATTCAGTATA CACAACTTCC GACCTTTACA AATTACAACA GTAACTTCAG CTATAAATTA
TAGCACATGT GAGTTAATTC GATGGATGGA TTCATGCATG TATATGTGTG CATATGCAGT ACGTGTTGCT GGCGCCGTGG
GTAGCGCACG GGTGGTATGA GGTGGCGACC AAGGGGTGGC GGGAGGTGGA TCTCGGGTAC ATCGCCATCC TCCCGTCGTT
GCTGCTGCGG ATGCTGCACA ACCAAGCCTG GATCACCATC TCCCGCCTCC AAAACGCCCG TGGCCGCCGC CAGATTGTTC
GCCGCGGCAT CGAGTTCGAC CAGGTTGACC GCGAGAGGAA CTGGTATGCC AAACACCATA AAATTACGTA CAACCCACGC
GGTGTGTTCG TGGCGGCTAG CTTCACCTTC GAGATTAATT AATTCAACCT CATTATAGTT GATGTGTTGT TACGTGTATG
GTGGTGTGCG TGCAGGGACG ACCAGATCAT CCTGAGCGGT ATCCTACTAT ACCTCGGCGC ACTGTACGTA CCGGGCGGGC
AACACTTACC GCTGTGGAGG ACGGATGGCG CGGGGCTGAT CGCCTTGCTG CATGCGGGGC CAGTGGAGTT CCTCTACTAC
TGGTTCCATC GTGCGTTGCA CCACCACTTT CTCTACACCC ACTACCACTC GCACCACCAC TCTTCAATCG TCACTGAGCC
CATCACATGT ACGTAATTAA TTGCCACTAG AGACGGTTTA TCCTCGAGGC TCCAAACATT ACATTCTCTT TTAGGCAATA
ACCTTTGAGC TTCTATATTA GTATCGAATT GTGTTGCGTC Ataaatattt ttacaaaatt tttattcatc atctaaagtt
atcaatgatc aaagttcaa

Locus: Os10g0471100

Loading...

Locus: Os10g0471100

Loading...