Os10t0471300-01

Locus

Os10g0471300

Description

Similar to Cyanate lyase (CYN).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYN

CGSNL Gene Name

CYANASE

Oryzabase Gene Symbol Synonym(s)

OsCYN

Oryzabase Gene Name Synonym(s)

cyanase

Transcript Evidence

AK105134 (DDBJ, Best hit)

Protein Evidence

Q9FWK4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: cyanate metabolic process (GO:0009439)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: cyanate hydratase activity (GO:0008824)

Molecular Function: hydro-lyase activity (GO:0016836)

Functional domain (InterPro)

Cyanate lyase, C-terminal (IPR003712)

Cyanase (IPR008076)

Lambda repressor-like, DNA-binding (IPR010982)

Full-length cDNA

001-102-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0471300-01)

RiceXPro (AK105134)

Others

Oryzabase (9400)

KEGG (Os10t0471300-01 (EC:4.2.1.104))

Transcript

818 bp

>Os10t0471300-01 Similar to Cyanate lyase (CYN).
AAAGCTGTGATTTTGAGGCCACCGTGCATCGCGCCGCCGCCGACGACGACCTCGACCCAC
TCACCTCGACTGCGACGCGTGGCGGCGGGAGGAGAGGAGAGGAGAGGGATATGGAGGGCG
GCGGCGGGGAGAGGGCGGCGGGGGTGGTGCGGCGGCTGATGGCGGCGAAGGCGGAGTCGC
GGAAGAGCTTCTCGGAGATCGGGGAGGAGGCGGGGCTGACCAACGTGTACGTGGCGCAGC
TGCTGCGGCGGCAGGCGCAGCTGAAGCCGGAGACGGCGCCGGCGCTGCGGGCGGCCGTGC
CGGGGCTCACCGACGACCTCGTCGCGCTCATGATGGAGCCGCCGTTCCGCTCCTACCACC
CGGACATCGTCCACGAGCCCGCCATCTACAGATTGAATGAAGCTGTTATGCATTTTGGAG
AGAGCATCAAGGAAATTATCAATGAGGAGTTTGGTGATGGAATCATGTCAGCTATAGACT
TCTACTGTTCGGTTGACAAGGTACAAGGTGCTGATGGAAAAGATCGCGTGGTGGTCACAT
TTGATGGGAAATATCTTCCTTACAGTGAGCAGAGATCTGATCATATGATGTCTAGGCTGA
CCCGCAAGACATCTTGAGATGGCTGGTGTTGTGGGAAAAATGATGTATCATCTGCTTCTG
CTTGTGGATTGAATAGAATCGAGCATGTTTTTTACTCCCAATAGTCGATGAAATAAACAT
ACTTTGTAATGATGTATACATGAATAAATTGTTTAAGCAGAGATACAGTTCGATGTCACC
TTTACTACTTCTATCATTGAATAAAGTTAATAAACAAC

CDS

507 bp

>Os10t0471300-01 Similar to Cyanate lyase (CYN).
ATGGAGGGCGGCGGCGGGGAGAGGGCGGCGGGGGTGGTGCGGCGGCTGATGGCGGCGAAG
GCGGAGTCGCGGAAGAGCTTCTCGGAGATCGGGGAGGAGGCGGGGCTGACCAACGTGTAC
GTGGCGCAGCTGCTGCGGCGGCAGGCGCAGCTGAAGCCGGAGACGGCGCCGGCGCTGCGG
GCGGCCGTGCCGGGGCTCACCGACGACCTCGTCGCGCTCATGATGGAGCCGCCGTTCCGC
TCCTACCACCCGGACATCGTCCACGAGCCCGCCATCTACAGATTGAATGAAGCTGTTATG
CATTTTGGAGAGAGCATCAAGGAAATTATCAATGAGGAGTTTGGTGATGGAATCATGTCA
GCTATAGACTTCTACTGTTCGGTTGACAAGGTACAAGGTGCTGATGGAAAAGATCGCGTG
GTGGTCACATTTGATGGGAAATATCTTCCTTACAGTGAGCAGAGATCTGATCATATGATG
TCTAGGCTGACCCGCAAGACATCTTGA

Protein

169 aa

>Os10t0471300-01 Similar to Cyanate lyase (CYN).
MEGGGGERAAGVVRRLMAAKAESRKSFSEIGEEAGLTNVYVAQLLRRQAQLKPETAPALR
AAVPGLTDDLVALMMEPPFRSYHPDIVHEPAIYRLNEAVMHFGESIKEIINEEFGDGIMS
AIDFYCSVDKVQGADGKDRVVVTFDGKYLPYSEQRSDHMMSRLTRKTS*

5'UTR

chr10:17471631..17471740 (+ strand) : 110 bp

CDS

chr10:17471741..17472021 (+ strand) : 281 bp

chr10:17473632..17473703 (+ strand) : 72 bp

chr10:17474111..17474219 (+ strand) : 109 bp

chr10:17474553..17474597 (+ strand) : 45 bp

3'UTR

chr10:17474598..17474798 (+ strand) : 201 bp

FASTA

>Os10t0471300-01 class=Sequence position=chr10:17471631..17474798 (+ strand)
AAAGCTGTGA TTTTGAGGCC ACCGTGCATC GCGCCGCCGC CGACGACGAC CTCGACCCAC TCACCTCGAC TGCGACGCGT
GGCGGCGGGA GGAGAGGAGA GGAGAGGGAT ATGGAGGGCG GCGGCGGGGA GAGGGCGGCG GGGGTGGTGC GGCGGCTGAT
GGCGGCGAAG GCGGAGTCGC GGAAGAGCTT CTCGGAGATC GGGGAGGAGG CGGGGCTGAC CAACGTGTAC GTGGCGCAGC
TGCTGCGGCG GCAGGCGCAG CTGAAGCCGG AGACGGCGCC GGCGCTGCGG GCGGCCGTGC CGGGGCTCAC CGACGACCTC
GTCGCGCTCA TGATGGAGCC GCCGTTCCGC TCCTACCACC CGGACATCGT CCACGAGCCC GCCATCTACA GGTGCCTCCT
CCTTCCCCTC CCTCCCATGG CCGTACCGTA CTCTGCTTCT CAATTGAGTC TCGCCTCTGA TTCCAAACCA TACATGTTGA
TGCTTTCCTT TTGATTGTTC TTCTAGAATT TTATCTTTGA Gaaaatctat cctacggttt tccgtggaga cggaatagta
ctactccctt atctctctct tcccctccat tcgatccctc tctctgtgaa taccacccat gagcacggag gcggcgacga
cggcgacggc aacggcgacg acggcggcaa cgacggcggc ggcaacgacg acgacggtgc cgtcaccacc agcccccgcg
gacgacctgg acgacagtcg gcggagctcc cgaccaccac gggcgacggc cgccgtcaag aagcctcccc atcaagctcc
tcaaggcgct cctcctcttc gtcgttcttg tcggtagctt cctcgccgct gccgccctcc tcctccttgg cggcgctggc
gcctcctacg gtcggggagc gatggacgcg gccaccgggg gcgagcactt ggcacaacat gagcgacgag gagctgctct
aggcggcgtc aatggagcca cgggtttggc ggtttggagc gaggcacgac gacgagcgac ggaatggcac aaggtaggca
ccagatctat cgcctcctct tcctcttcct ccgccgtcgc cccgctgctc gacttccctg acccacgact cctcctcctc
ctctctcttg ggatatcaca ctgataccca gataccaagg cctgatacct aggtatcagc tcgataccca gggtaccagg
tatcagtcga tacccaggta ccaagacctg atacctaggt accaaggcct gatacatagg tatcagctcg atacccaggg
taccaggtat cagtcgatac tagggtgtac caggtatcag tcgatagtcg ataccagggt accagctgat accaatgtac
caggtaccac ctcggtacct tacccaagat accaaggagg attggATATG GTGGAATCGC AGGATAGCGT GGGCCTCCCC
ACAAAATTGA TGAAGCTTAT TAAATCTCTC GGGATTTTAG TTATCCCGTG ACTGCTAGGA GCAACGGAAT ACCGTGGGGT
AGCAGCCCTC TTTATCTTTT CGTTATTTAT TATACATGCT TGCTAGAGTT GTGAGGATGG CGAAATTAAG TAATTTCTTT
GTGCTGTTCT TGATTCTGAA ATTTTGAACc tttggcatag aaaaatagac acgatgttgc ttaattctat cgcgttggcg
aagactaatt atattcttag ggattctatg tcagaaagtg aatatttatt tcaTTTTTCC ATTAAAATTA AGAAGCCAAA
TAGTTAACTT GTAAGAGAAT ATGCTAAAGA ACATGATTAG TTCTGTTTGC TTTGTAACAT GCAAGAGCCT TTTATCGACA
TATATGTGCT ATTGTAATGG AAGATGTTGT CTCTATGAAA ATTTACCAGA TTATTACAAG TTTAGTACAC GGTTGATTTA
AATTATTGTG GTAATGCACT TTTACAACAC TCTAGAAAAG GATTCTTGTT GATATTTTTT TTAATTATAT ATTGCGCTCA
GATTGAATGA AGCTGTTATG CATTTTGGAG AGAGCATCAA GGAAATTATC AATGAGGAGT TTGGTGATGG AATGTAAGAT
ATCTGCCTAT GCTTCATTCT ATTTGATTTT CATTTACCCC AGTATTTCTT GACTTCCTGT TCCTGGTAAC TGCACATGGA
CGAAGTTAAG GATTTGTATA CAGTAAGCAC TGATGTAAAG CATGCACCTT TCTCTGAAAA AAAATGCAAA GCATGTACCT
TTATGGGAAC AATCCCTGGA GGTTCATTAA GTCTAGATTA ATCACTATAT TCTTATTAGT GGTAGCTGGT AACCGATCAC
TATATTCTTA TCAGGATGTC AAGTAAAATA TTTTCTTCTC TTCAGGCTGA TATAGAGGCC TTTGTATTTC AAGACTACTG
ACCATCTAAT TTTGGCTGCC ATGCTTATAT CCTTTGAAAA AAAAAGGTGA AAGAATCCGT TTAACTGCTT CCTAATGCAG
CATGTCAGCT ATAGACTTCT ACTGTTCGGT TGACAAGGTA CAAGGTGCTG ATGGAAAAGA TCGCGTGGTG GTCACATTTG
ATGGGAAATA TCTTCCTTAC AGTGAGCAGG TTAGTGTTTT CTTGCTTCCC TATTCTCGAT ATAATCATCT TACTTTTTTG
AATTGATGCA TAATTGAATA TGTTGAATCA TCTGCCGTCT GTATGGAAGA TTTTGGAATT GAATATATGC TTTACATTAT
ACTTAACTTT GGAAGTGATC CGTCACACCA TTGTACTATC CTTGATTATT ATTAGCAGAT AAGCGTTGGA TGAGGCTACA
GAGTTACAGA TTTAATCATT ATACCCATTC TATCTTTTTA CTAGAATTCT TCCATCTTAT TACCTCTCTT GCTGATCTGA
ATTTGACAAG CAGTTCTAAG CACAGAATTT TCATATTTGC AGAGATCTGA TCATATGATG TCTAGGCTGA CCCGCAAGAC
ATCTTGAGAT GGCTGGTGTT GTGGGAAAAA TGATGTATCA TCTGCTTCTG CTTGTGGATT GAATAGAATC GAGCATGTTT
TTTACTCCCA ATAGTCGATG AAATAAACAT ACTTTGTAAT GATGTATACA TGAATAAATT GTTTAAGCAG AGATACAGTT
CGATGTCACC TTTACTACTT CTATCATTGA ATAAAGTTAA TAAACAAC

Locus: Os10g0471300

Loading...

Locus: Os10g0471300

Loading...