Os10t0478000-01

Locus

Os10g0478000

Description

Transcriptional regulator, Regulator of meristem activity, Regulation of inflorescence development

RAP-DB Gene Symbol Synonym(s)

G1L5, OsG1L5, TAW1

RAP-DB Gene Name Synonym(s)

G1 LIKE PROTEIN 5, TAWAWA1

CGSNL Gene Symbol

G1L5

CGSNL Gene Name

G1 LIKE PROTEIN 5

Oryzabase Gene Symbol Synonym(s)

OsG1L5, TAW1, OsTAW1

Oryzabase Gene Name Synonym(s)

TAWAWA1

Transcript Evidence

AK243306

AB512494

Protein Evidence

Q7XDD0

Literature

PMID: 23267064

PMID: 19901325

Note

Manual Curation

July 5, 2016

Functional domain (InterPro)

ALOG domain (IPR006936)

Full-length cDNA

J100055D15 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0478000-01)

Others

Oryzabase (8886)

KEGG (Os10t0478000-01)

Transcript

1110 bp

>Os10t0478000-01 Transcriptional regulator, Regulator of meristem activity, Regulation of inflorescence development
GCTATCGGCTCCTTCTCGCCCAGCTTTTGCTCACGTCACATCACCTTCCACCTCCACCCC
TCCACTCGCTCGCTCGCTTGCTTGCTCCAATTAATACCTCTTCTCCTTCTCCCCCAGCAA
CTAGCTTCCTTCTCCGCTTTTGCAGCTCGCCGCCGCCGCCGCCGCCGCCGCCGCGACACG
GCGCGCATATGGTCGTCGTCGTCGTCGTCGTCGTCGCTGGAGAAGACGAAGAAAGATAGT
AGACCTGAGCTGGGGGGGCGGTGAATTCGCCGGAGAGCTAGCTAAGATCGACGATGGAGT
TCGTGGCGCACGCGGCGGCGCCGGACAGCCCGCACTCGGACAGCGGCGGAGGAGGAGGGG
GAATGGCGACGGGGGCGACGTCGGCGTCGGCGGCGGGGGCGTCGCCGAGCAGGTACGAGT
CGCAGAAGCGGCGGGACTGGAACACGTTCGGGCAGTACCTCCGCAACCACCGGCCGCCGC
TGTCGCTGGCGCGGTGCAGCGGCGCGCACGTCCTGGAGTTCCTCCGCTACCTGGACCAGT
TCGGCAAGACCAAGGTGCACGCGCCGGCGTGCCCCTTCTTCGGCCACCCGGCGCCGCCGG
CGCCGTGCCCGTGCCCGCTTCGCCAGGCGTGGGGCAGCCTCGACGCCCTCGTCGGCCGCC
TCCGCGCCGCCTACGAGGAGAACGGCGGCCGCCCCGAGAACAACCCCTTCGGCGCCCGCG
CCGTCCGCCTCTACCTCCGCGAGGTCCGCGAGCACCAGGCGCGCGCACGCGGCGTCAGCT
ACGAGAAGAAGAAGCGCAAGAAGCCACCCCACCCCTCCTCCGCCGCCGCCGCGCACGACG
ACGCCGCCAACGGCGCCCTCCACCACCACCACCACATGCCGCCGCCTCCTCCCGGCGCCG
CCGCCTGAGCCGAGCCGAGCTTGCTCCAAGATCGCCGGAAAACGAGCTGCTAGCCTCCTA
CGCATGCACTAGTTACTCCACTCCACTCCACTCCACTATGATCCCTAGCTAGGCTGCTCT
TGCTACTAGCAAAACTACGGATTAATCTCCATGCTTGCTACTGCTGCTGCTGCTGCTACT
GCATCTAATTAATTAGGTTGATTATTTCCT

CDS

615 bp

>Os10t0478000-01 Transcriptional regulator, Regulator of meristem activity, Regulation of inflorescence development
ATGGAGTTCGTGGCGCACGCGGCGGCGCCGGACAGCCCGCACTCGGACAGCGGCGGAGGA
GGAGGGGGAATGGCGACGGGGGCGACGTCGGCGTCGGCGGCGGGGGCGTCGCCGAGCAGG
TACGAGTCGCAGAAGCGGCGGGACTGGAACACGTTCGGGCAGTACCTCCGCAACCACCGG
CCGCCGCTGTCGCTGGCGCGGTGCAGCGGCGCGCACGTCCTGGAGTTCCTCCGCTACCTG
GACCAGTTCGGCAAGACCAAGGTGCACGCGCCGGCGTGCCCCTTCTTCGGCCACCCGGCG
CCGCCGGCGCCGTGCCCGTGCCCGCTTCGCCAGGCGTGGGGCAGCCTCGACGCCCTCGTC
GGCCGCCTCCGCGCCGCCTACGAGGAGAACGGCGGCCGCCCCGAGAACAACCCCTTCGGC
GCCCGCGCCGTCCGCCTCTACCTCCGCGAGGTCCGCGAGCACCAGGCGCGCGCACGCGGC
GTCAGCTACGAGAAGAAGAAGCGCAAGAAGCCACCCCACCCCTCCTCCGCCGCCGCCGCG
CACGACGACGCCGCCAACGGCGCCCTCCACCACCACCACCACATGCCGCCGCCTCCTCCC
GGCGCCGCCGCCTGA

Protein

205 aa

>Os10t0478000-01 Transcriptional regulator, Regulator of meristem activity, Regulation of inflorescence development
MEFVAHAAAPDSPHSDSGGGGGGMATGATSASAAGASPSRYESQKRRDWNTFGQYLRNHR
PPLSLARCSGAHVLEFLRYLDQFGKTKVHAPACPFFGHPAPPAPCPCPLRQAWGSLDALV
GRLRAAYEENGGRPENNPFGARAVRLYLREVREHQARARGVSYEKKKRKKPPHPSSAAAA
HDDAANGALHHHHHMPPPPPGAAA*

5'UTR

chr10:17889439..17889724 (- strand) : 286 bp

chr10:17889114..17889120 (- strand) : 7 bp

CDS

chr10:17888499..17889113 (- strand) : 615 bp

3'UTR

chr10:17888297..17888498 (- strand) : 202 bp

FASTA

>Os10t0478000-01 class=Sequence position=chr10:17888297..17889724 (- strand)
GCTATCGGCT CCTTCTCGCC CAGCTTTTGC TCACGTCACA TCACCTTCCA CCTCCACCCC TCCACTCGCT CGCTCGCTTG
CTTGCTCCAA TTAATACCTC TTCTCCTTCT CCCCCAGCAA CTAGCTTCCT TCTCCGCTTT TGCAGCTCGC CGCCGCCGCC
GCCGCCGCCG CCGCGACACG GCGCGCATAT GGTCGTCGTC GTCGTCGTCG TCGTCGCTGG AGAAGACGAA GAAAGATAGT
AGACCTGAGC TGGGGGGGCG GTGAATTCGC CGGAGAGCTA GCTAAGGTGA GTTTCGTTTT CGGTTTCGGT TTCGATCGAT
TTGTTGGTGC AGATGCATCT GGGAGCTAGA GAACTATTTA TAGTGGCTGC GGTGCGGTGC GGCGTCGCCA CGCCGCGCAC
GCGCTCGCCC ACGTCGCGCG CGCGCGGGCG CGCGTCCACT CTCTCTCTCT CTTGGACCAC TGCGCGCGCG GGCGCGCGTC
GGCGTCGCCA CGGCTTCTCA AGAACGCGCG CGCGCGCACT GATTCCCAGA TAGATAGATC TATATCTGTT CGTCTTCCTC
AGCTATGGTG TGGTGGTGGT GGTGGTGTTT GTGGTGTTGT GCAGATCGAC GATGGAGTTC GTGGCGCACG CGGCGGCGCC
GGACAGCCCG CACTCGGACA GCGGCGGAGG AGGAGGGGGA ATGGCGACGG GGGCGACGTC GGCGTCGGCG GCGGGGGCGT
CGCCGAGCAG GTACGAGTCG CAGAAGCGGC GGGACTGGAA CACGTTCGGG CAGTACCTCC GCAACCACCG GCCGCCGCTG
TCGCTGGCGC GGTGCAGCGG CGCGCACGTC CTGGAGTTCC TCCGCTACCT GGACCAGTTC GGCAAGACCA AGGTGCACGC
GCCGGCGTGC CCCTTCTTCG GCCACCCGGC GCCGCCGGCG CCGTGCCCGT GCCCGCTTCG CCAGGCGTGG GGCAGCCTCG
ACGCCCTCGT CGGCCGCCTC CGCGCCGCCT ACGAGGAGAA CGGCGGCCGC CCCGAGAACA ACCCCTTCGG CGCCCGCGCC
GTCCGCCTCT ACCTCCGCGA GGTCCGCGAG CACCAGGCGC GCGCACGCGG CGTCAGCTAC GAGAAGAAGA AGCGCAAGAA
GCCACCCCAC CCCTCCTCCG CCGCCGCCGC GCACGACGAC GCCGCCAACG GCGCCCTCCA CCACCACCAC CACATGCCGC
CGCCTCCTCC CGGCGCCGCC GCCTGAGCCG AGCCGAGCTT GCTCCAAGAT CGCCGGAAAA CGAGCTGCTA GCCTCCTACG
CATGCACTAG TTACTCCACT CCACTCCACT CCACTATGAT CCCTAGCTAG GCTGCTCTTG CTACTAGCAA AACTACGGAT
TAATCTCCAT GCTTGCTACT GCTGCTGCTG CTGCTACTGC ATCTAATTAA TTAGGTTGAT TATTTCCT