Os10t0485600-01

Locus

Os10g0485600

Description

Dicer-like protein, Phased small RNA biogenesis

RAP-DB Gene Symbol Synonym(s)

DCL3B, OsDCL3b

RAP-DB Gene Name Synonym(s)

DICER-LIKE 3B, Endoribonuclease Dicer homolog 3b, Dicer-like protein 3b

CGSNL Gene Symbol

DCL3B

CGSNL Gene Name

DICER-LIKE 3B

Oryzabase Gene Symbol Synonym(s)

OsDCL3b

Oryzabase Gene Name Synonym(s)

Endoribonuclease Dicer homolog 3b, Dicer-like protein 3b

Transcript Evidence

Inferred from literature

Protein Evidence

Q7XD96

Literature

PMID: 21973320

PMID: 18826656

Note

Manual Curation

March 24, 2015

Gene Ontology (GO)

Biological Process: RNA processing (GO:0006396)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: RNA binding (GO:0003723)

Molecular Function: ribonuclease III activity (GO:0004525)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: endoribonuclease activity, producing 5'-phosphomonoesters (GO:0016891)

Functional domain (InterPro)

Helicase superfamily 1/2, ATP-binding domain (IPR014001)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

DEAD/DEAH box helicase domain (IPR011545)

Helicase, C-terminal (IPR001650)

Dicer dimerisation domain (IPR005034)

PAZ domain (IPR003100)

Ribonuclease III domain (IPR000999)

Expression Databases

TENOR (Os10t0485600-00)

Others

Oryzabase (8310)

Transcript

5122 bp

>Os10t0485600-01 Dicer-like protein, Phased small RNA biogenesis
ATGGCCGACGACGAGGCTGCCGTCCTCCCGCCCCCGCCTCCGCTGCCGCCGCCTTGCCGC
CCCCACAGGCAGCTCCGCCCGAGGGGGTCTCGACCGACTGCTGATACCACCCCTCGCACT
AGCCAGTTGGTGGAGGTGTTCGAGGCGGCGCTGCGGGGGAACACCATCGCGGTGCTCGAC
ACGGGGTCCGGGAAGACCATGGTCGCCGTCATGCTCGCGCGCGAGCACGCACGCCGGGTG
CGCGCCGGGGAGGCGCCGCGGCGGATCGTGGTGTTCCTCGCGCCCACCGTGCACCTCGTC
CATCAGCAATTCGAGGTGATTCGTGAGTACACTGACCTCGACGTGATGATGTGCTCTGGA
GCATCGCGGGTTGGCGAATGGGGCGCCGATCATTGGAAGGAGGAAGTTGGGAGAAATGAG
ATCGTTGTTATGACGCCACAGATACTGTTGGATGCTCTGCGGCATGCTTTTCTGACAATG
AGTGCAGTGAGCTTGCTAATATTTGATGAATGTCATCGTGCTTGTGGAAGCCATCCATAT
GCACGAATAATGAAGGAATTTTATTTTGGGTCTCAGTGGAGGCCAGATGTATTTGGAATG
ACAGCCTCCCCCGTTGCTACTAAAGGTGCTTCCACACTACACAATTGTGAAGCACACATT
TCTCAACTAGAACTAACCTTGGATGCCAAGATATACATCGTAGAAGATCGAAATGAGCTT
GAGAGCTTTTCCCCTCCTACAACAATTGTGAACAAATACTATGATGCTTACATGGTTGAT
TTTGATAATCTGAAATCAAAGCTTCAGATATTTTCTGATGAGTTTGATTCTTTGTTGGTT
GGTCTTCAAGAATCGCCATCTAATAAATTTAAAGACACCGATAATATCCTAGAGACTTCA
AGAAAGAGCTTGTCCAGATACCATGGGAAAATATTGTACAGCCTAAACGATCTTGGTCCA
ATTATCACCTCTGAGGTAGTCAAAATACATATTGAAAGCGTTAAGCCATTATGTGATTCT
GAAGACTGCATTTTTTCTAAAGCTAGCTTGTGCTTACATATGTCTTATTTTAAAGAAGCT
TTAAGTCTAATAGAGGAAATTCTTCCACAAGGATATGGTGAACTAATGAAATCAGAATCT
GGTTCTGAGGAATTAACTAAAAGGGGATACATTTCTTCAAAAGTGAATACGCTAATCAAC
ATCTTCAAATCGTTTGGGTCATCAAATGAAGTGCTTTGCCTAATTTTCGTAGACAGAATT
ATAACAGCTAAAGCCGTCGAAAGGTTTATGAGAGGAATTGTTAACTTCTCTTGTTTTTCA
ATTTCTTACTTGACTGGAGGGAGTACATCAAAAGATGCTCTGAGTCCAGCAGTTCAGAGA
TTTACTTTGGATTTGTTCCGAGCTGGAAAGGTGAACTTGCTTTTTACAACAGATGTGACT
GAAGAGGGCGTCGATGTACCTAACTGTTCTTGTGTGATACGCTTCGACCTACCCAGAACT
GTTTGTAGCTATGTCCAATCTCGTGGTCGTGCTAGAAGGAACAACTCGGAATTTATTCTT
ATGATTGAGAGGGGAAACTTGCAGCAGCAAGAACACATATTTCGTATGATACAGACTGGT
TACTATGTTAAAAACTGTGCACTCTATAGACACCCCAATGCTTTATCCTATGACTTGTCT
ATCCAAGGGATGTACACCTACCAAGTTCAGTCAACTGGAGCAACTATAACCGCAGATTGC
TGTGTCAACCTAATTCGTAAATACTGTGAGAAGCTTCCTAAAGATAGGTATTTCATGCCA
AAGCCTTCCTTTGAGGTGACCATTGAAGATGGATTATTCAAATGCACATTGACGCTACCT
CGAAATGCAGCATTTCAAAGTATAGTTGGCCCTTTAAGCAGTTCAAGTAATTTATCCAAG
CAGCTTGTATCCCTAGAGGCCTGCAAGAAATTGCATCAACTGGGAGAACTTAATGATCAT
CTTGTACCTTTGACTGAAGAACCTATGGATACAGATTTCACTACAGCAGATGAAAAATGC
ATATCTGGACCAGGAACAACTAAAAGGAAGGAGCTTCATGGTACTACATGTGTTCTTGCT
TTATCAGGAACTTGGATTCATGACAGTGAAAATATTACACTGAATACTTACAGAATTGAT
TTTCTTTGTGACCAAGAGGGTGAAAACTATGCTGGGTTTGTTCTCTTAATGGAACCAGAA
CTTGATGATGATGTGGCACCCTCAAAAATGGATCTGTTCCTGATCCCTAATAAAATGGTC
TACACCACTGTAACTCCTCGCGGAAAAGTTCAACTAAACAAAAAGCAGTTAGGTAAAGGG
AAATTGTTCCAAGAATTCTTTTTCAATGGAATCTTTGGTAGATTATTTCATGGTTCTCGA
AAAAGTGGAGCACAAAGGGATTTTATTTTCAAAAAGGGTCATGAAATACAGTGGAACACG
GAAAGCATGTACTTGCTTTTACCTTTGAGGGATTCTTCATATATCCAGGATGACCTAAGC
ATACACTGGGAAGCAATTGAATCTTGTGCTGGTGCAGTTGAGCAGTTGTGGAGTTCGTAT
CAAGGAGATGAAAATGTCATTCCTGTAAATTGTATTCCACAAAAAAGAAGAGGGGGCCAA
GAAGAAATTATTCATCTGGCCAATAAGTCTCTTCATTGTTCCAGCATCAAAGATTCAGTC
GTGCTATCACTGCATACAGGAAGGATATACACTGTTCTTGATTTGATCTTAGACACAACT
GCAGAGGACTCGTTTGATGAGATGTGTAAGGGGAAAGCCTCACCTTTTACTTCATTTGTG
GACTATTACCATCAAAAGTATGGTATTATTATTCAACATCCAGAACAACCACTATTGCTG
TTAAAGCAAAGCCACAATGCACACAATCTTCTCTTTTCAAAATTGAAGTATCTAGATGGC
TCCACTGGCAAACCTCTGCTCATGGAAAAAGAACAAATTCATGCTCGGGTTCCACCTGAA
CTACTTATCCATCTCGATGTAACAACTGATATTCTGAAGTCATTTTATTTACTCCCTTCT
GTAATACATCGGCTTCAGTCACTTATGCTAGCCAGCCAGCTTCGCAGAGAAATTGGTTAC
AATCAACACATACCAGTCACTTTGATTTTGGAAGCTATAACAACTTTAAGATGCTGTGAG
ACATTTTCTCTGGAGCGTTTAGAGCTGTTAGGAGACTCCGTGCTAAAGTATGTGGTAGGA
TGTGACCTTTTCCTAAGGTATCCTATGAAACATGAAGGTCAGCTCTCTGATATGAGATCC
AAGGCTGTCTGCAATGCTACACTTCATAAACATGGAATATGGCGGTCGTTGCAGGGTTAT
GTACGTGATAATGCTTTTGACCCACGGCGTTGGGTTGCTCCTGGACAGATATCGTTGCGC
CCTTTTCCTTGTAACTGTGGAATCGAGACTGCATTTGTTCCTTCTCATAGAAGGTATATC
CGAGATGACCCATCTTTTTTTGTGGGAAAACCATGTGACAGAGGTCATAGGTGGATGTGC
TCAAAAACAATATCTGATTGTGTTGAAGCACTGGTTGGAGCATATTATGTTGGTGGTGGC
ATTGCTGCTGCACTTTGGGTTATGAGGTGGTTTGGAATCGATATCAAATGTGATATGAAG
CTATTGCAGGAAGTGAAGTTCAATGCATCTCATTTATGCTCCTTATCAAAAATAAATGAC
ATTGAGGAACTGGAAGCAAAACTGAAGTACAACTTCTCAGTCAAGGGCCTTCTTTTGGAA
GCCATAACTCATCCATCTCTGCAGGAATTAGGTGTTGATTACTGTTACCAGCGTCTTGAA
TTTCTTGGTGATTCTGTGCTGGATCTACTTCTTACACGTCATCTCTATGCTACTCATACT
GATGTTGATCCTGGAGAATTAACGGATTTACGCTCCGCTTTGGTTAGTAATGAGAATTTT
GCACAAGCAGTTGTAAGAAACAACATTCACAGTCATCTACAACATGGATCCGGAATACTT
TTGGAGCAAATTACTGAATATGTCAGGTCAAATTTGGAGTGTCAAGGGAAAGAGAGTGAA
TTCCTTCAACATACTACATGTAAAGTACCTAAGGTTCTTGGTGACATTATGGAAAGCATC
GCTGGTGCAGTATTTATAGACACCGATTTTAATGTTGACATGGTTTGGGAGATTTTCGAG
CCATTGCTTTCTCCACTGATTACACCTGATAAGCTTGCATTGCCACCTTACCGTGAGTTG
CTGGAGCTATGCAGTCACATTGGTTGCTTCTTAAATTCAAAATGCACCAGTAAAGGAGAA
GAAGTAATTATAGAGATGTCACTGCAACTACGAGATGAGCTGCTGGTAGCACAAGGGCAT
GACAGAAACAAAAAGAGGGCAAAGGCAAAAGCAGCATCTCGTATTTTGGCAGATCTTAAG
CAACAGGGTCTTTCAATTAAACAATGTTTGTCCAAGGCTAAACAGCTGGATATCGTGACT
TCAGATCTTCAGTTTGACTTGACAAGTTCAGGAACACAACTCAGTTATTCTGATTTGAAT
GACTATCATATCCTAGAAGGTCTTTCCTCAGTAAAGAAAGAAGTTGTGCTTCCACTCAAA
ATGGAGAAAGGTGGACCTCGAAGTGCGCTTTTCAAGCTATGCAAGATTTTGCAGTGGCCA
ATGCCAGAATTCGAATTTGTGGAACAAAGGTTCAGGACTCCTATTGTTATGGATGGGGCG
ACAACAACAAACTTCAATAGCTTTGTTTCGACAATCACCTTGCACATACCTGACGCAACA
ACCATTACATTTCAAGGTGAGCGACGTACTGACAAAAAGAGTGCTCAGGATTCAGCATCC
TTGATGATGCTTCACAAGCTTCAAGAACTCAAGATCTGTATATGCAAGACTTAGCAAAGC
ATCATTGAGACATGGGCCAATATGCCAGTTAACGATTGCGACTAGCTAATGCGAGCTACT
TCCCTCCCAAAGTGAGATGCGACGAAAATATTTCTGAAAAGCTCGATGCTCCAGACTGTC
ACTGATCCTATGTTATTTTGGGGAAGAAGATCCCTATGGTATACTACCTTGCATTACCTG
GATACATTGTTGTCGAGTTTCC

CDS

4914 bp

>Os10t0485600-01 Dicer-like protein, Phased small RNA biogenesis
ATGGCCGACGACGAGGCTGCCGTCCTCCCGCCCCCGCCTCCGCTGCCGCCGCCTTGCCGC
CCCCACAGGCAGCTCCGCCCGAGGGGGTCTCGACCGACTGCTGATACCACCCCTCGCACT
AGCCAGTTGGTGGAGGTGTTCGAGGCGGCGCTGCGGGGGAACACCATCGCGGTGCTCGAC
ACGGGGTCCGGGAAGACCATGGTCGCCGTCATGCTCGCGCGCGAGCACGCACGCCGGGTG
CGCGCCGGGGAGGCGCCGCGGCGGATCGTGGTGTTCCTCGCGCCCACCGTGCACCTCGTC
CATCAGCAATTCGAGGTGATTCGTGAGTACACTGACCTCGACGTGATGATGTGCTCTGGA
GCATCGCGGGTTGGCGAATGGGGCGCCGATCATTGGAAGGAGGAAGTTGGGAGAAATGAG
ATCGTTGTTATGACGCCACAGATACTGTTGGATGCTCTGCGGCATGCTTTTCTGACAATG
AGTGCAGTGAGCTTGCTAATATTTGATGAATGTCATCGTGCTTGTGGAAGCCATCCATAT
GCACGAATAATGAAGGAATTTTATTTTGGGTCTCAGTGGAGGCCAGATGTATTTGGAATG
ACAGCCTCCCCCGTTGCTACTAAAGGTGCTTCCACACTACACAATTGTGAAGCACACATT
TCTCAACTAGAACTAACCTTGGATGCCAAGATATACATCGTAGAAGATCGAAATGAGCTT
GAGAGCTTTTCCCCTCCTACAACAATTGTGAACAAATACTATGATGCTTACATGGTTGAT
TTTGATAATCTGAAATCAAAGCTTCAGATATTTTCTGATGAGTTTGATTCTTTGTTGGTT
GGTCTTCAAGAATCGCCATCTAATAAATTTAAAGACACCGATAATATCCTAGAGACTTCA
AGAAAGAGCTTGTCCAGATACCATGGGAAAATATTGTACAGCCTAAACGATCTTGGTCCA
ATTATCACCTCTGAGGTAGTCAAAATACATATTGAAAGCGTTAAGCCATTATGTGATTCT
GAAGACTGCATTTTTTCTAAAGCTAGCTTGTGCTTACATATGTCTTATTTTAAAGAAGCT
TTAAGTCTAATAGAGGAAATTCTTCCACAAGGATATGGTGAACTAATGAAATCAGAATCT
GGTTCTGAGGAATTAACTAAAAGGGGATACATTTCTTCAAAAGTGAATACGCTAATCAAC
ATCTTCAAATCGTTTGGGTCATCAAATGAAGTGCTTTGCCTAATTTTCGTAGACAGAATT
ATAACAGCTAAAGCCGTCGAAAGGTTTATGAGAGGAATTGTTAACTTCTCTTGTTTTTCA
ATTTCTTACTTGACTGGAGGGAGTACATCAAAAGATGCTCTGAGTCCAGCAGTTCAGAGA
TTTACTTTGGATTTGTTCCGAGCTGGAAAGGTGAACTTGCTTTTTACAACAGATGTGACT
GAAGAGGGCGTCGATGTACCTAACTGTTCTTGTGTGATACGCTTCGACCTACCCAGAACT
GTTTGTAGCTATGTCCAATCTCGTGGTCGTGCTAGAAGGAACAACTCGGAATTTATTCTT
ATGATTGAGAGGGGAAACTTGCAGCAGCAAGAACACATATTTCGTATGATACAGACTGGT
TACTATGTTAAAAACTGTGCACTCTATAGACACCCCAATGCTTTATCCTATGACTTGTCT
ATCCAAGGGATGTACACCTACCAAGTTCAGTCAACTGGAGCAACTATAACCGCAGATTGC
TGTGTCAACCTAATTCGTAAATACTGTGAGAAGCTTCCTAAAGATAGGTATTTCATGCCA
AAGCCTTCCTTTGAGGTGACCATTGAAGATGGATTATTCAAATGCACATTGACGCTACCT
CGAAATGCAGCATTTCAAAGTATAGTTGGCCCTTTAAGCAGTTCAAGTAATTTATCCAAG
CAGCTTGTATCCCTAGAGGCCTGCAAGAAATTGCATCAACTGGGAGAACTTAATGATCAT
CTTGTACCTTTGACTGAAGAACCTATGGATACAGATTTCACTACAGCAGATGAAAAATGC
ATATCTGGACCAGGAACAACTAAAAGGAAGGAGCTTCATGGTACTACATGTGTTCTTGCT
TTATCAGGAACTTGGATTCATGACAGTGAAAATATTACACTGAATACTTACAGAATTGAT
TTTCTTTGTGACCAAGAGGGTGAAAACTATGCTGGGTTTGTTCTCTTAATGGAACCAGAA
CTTGATGATGATGTGGCACCCTCAAAAATGGATCTGTTCCTGATCCCTAATAAAATGGTC
TACACCACTGTAACTCCTCGCGGAAAAGTTCAACTAAACAAAAAGCAGTTAGGTAAAGGG
AAATTGTTCCAAGAATTCTTTTTCAATGGAATCTTTGGTAGATTATTTCATGGTTCTCGA
AAAAGTGGAGCACAAAGGGATTTTATTTTCAAAAAGGGTCATGAAATACAGTGGAACACG
GAAAGCATGTACTTGCTTTTACCTTTGAGGGATTCTTCATATATCCAGGATGACCTAAGC
ATACACTGGGAAGCAATTGAATCTTGTGCTGGTGCAGTTGAGCAGTTGTGGAGTTCGTAT
CAAGGAGATGAAAATGTCATTCCTGTAAATTGTATTCCACAAAAAAGAAGAGGGGGCCAA
GAAGAAATTATTCATCTGGCCAATAAGTCTCTTCATTGTTCCAGCATCAAAGATTCAGTC
GTGCTATCACTGCATACAGGAAGGATATACACTGTTCTTGATTTGATCTTAGACACAACT
GCAGAGGACTCGTTTGATGAGATGTGTAAGGGGAAAGCCTCACCTTTTACTTCATTTGTG
GACTATTACCATCAAAAGTATGGTATTATTATTCAACATCCAGAACAACCACTATTGCTG
TTAAAGCAAAGCCACAATGCACACAATCTTCTCTTTTCAAAATTGAAGTATCTAGATGGC
TCCACTGGCAAACCTCTGCTCATGGAAAAAGAACAAATTCATGCTCGGGTTCCACCTGAA
CTACTTATCCATCTCGATGTAACAACTGATATTCTGAAGTCATTTTATTTACTCCCTTCT
GTAATACATCGGCTTCAGTCACTTATGCTAGCCAGCCAGCTTCGCAGAGAAATTGGTTAC
AATCAACACATACCAGTCACTTTGATTTTGGAAGCTATAACAACTTTAAGATGCTGTGAG
ACATTTTCTCTGGAGCGTTTAGAGCTGTTAGGAGACTCCGTGCTAAAGTATGTGGTAGGA
TGTGACCTTTTCCTAAGGTATCCTATGAAACATGAAGGTCAGCTCTCTGATATGAGATCC
AAGGCTGTCTGCAATGCTACACTTCATAAACATGGAATATGGCGGTCGTTGCAGGGTTAT
GTACGTGATAATGCTTTTGACCCACGGCGTTGGGTTGCTCCTGGACAGATATCGTTGCGC
CCTTTTCCTTGTAACTGTGGAATCGAGACTGCATTTGTTCCTTCTCATAGAAGGTATATC
CGAGATGACCCATCTTTTTTTGTGGGAAAACCATGTGACAGAGGTCATAGGTGGATGTGC
TCAAAAACAATATCTGATTGTGTTGAAGCACTGGTTGGAGCATATTATGTTGGTGGTGGC
ATTGCTGCTGCACTTTGGGTTATGAGGTGGTTTGGAATCGATATCAAATGTGATATGAAG
CTATTGCAGGAAGTGAAGTTCAATGCATCTCATTTATGCTCCTTATCAAAAATAAATGAC
ATTGAGGAACTGGAAGCAAAACTGAAGTACAACTTCTCAGTCAAGGGCCTTCTTTTGGAA
GCCATAACTCATCCATCTCTGCAGGAATTAGGTGTTGATTACTGTTACCAGCGTCTTGAA
TTTCTTGGTGATTCTGTGCTGGATCTACTTCTTACACGTCATCTCTATGCTACTCATACT
GATGTTGATCCTGGAGAATTAACGGATTTACGCTCCGCTTTGGTTAGTAATGAGAATTTT
GCACAAGCAGTTGTAAGAAACAACATTCACAGTCATCTACAACATGGATCCGGAATACTT
TTGGAGCAAATTACTGAATATGTCAGGTCAAATTTGGAGTGTCAAGGGAAAGAGAGTGAA
TTCCTTCAACATACTACATGTAAAGTACCTAAGGTTCTTGGTGACATTATGGAAAGCATC
GCTGGTGCAGTATTTATAGACACCGATTTTAATGTTGACATGGTTTGGGAGATTTTCGAG
CCATTGCTTTCTCCACTGATTACACCTGATAAGCTTGCATTGCCACCTTACCGTGAGTTG
CTGGAGCTATGCAGTCACATTGGTTGCTTCTTAAATTCAAAATGCACCAGTAAAGGAGAA
GAAGTAATTATAGAGATGTCACTGCAACTACGAGATGAGCTGCTGGTAGCACAAGGGCAT
GACAGAAACAAAAAGAGGGCAAAGGCAAAAGCAGCATCTCGTATTTTGGCAGATCTTAAG
CAACAGGGTCTTTCAATTAAACAATGTTTGTCCAAGGCTAAACAGCTGGATATCGTGACT
TCAGATCTTCAGTTTGACTTGACAAGTTCAGGAACACAACTCAGTTATTCTGATTTGAAT
GACTATCATATCCTAGAAGGTCTTTCCTCAGTAAAGAAAGAAGTTGTGCTTCCACTCAAA
ATGGAGAAAGGTGGACCTCGAAGTGCGCTTTTCAAGCTATGCAAGATTTTGCAGTGGCCA
ATGCCAGAATTCGAATTTGTGGAACAAAGGTTCAGGACTCCTATTGTTATGGATGGGGCG
ACAACAACAAACTTCAATAGCTTTGTTTCGACAATCACCTTGCACATACCTGACGCAACA
ACCATTACATTTCAAGGTGAGCGACGTACTGACAAAAAGAGTGCTCAGGATTCAGCATCC
TTGATGATGCTTCACAAGCTTCAAGAACTCAAGATCTGTATATGCAAGACTTAG

Protein

1637 aa

>Os10t0485600-01 Dicer-like protein, Phased small RNA biogenesis
MADDEAAVLPPPPPLPPPCRPHRQLRPRGSRPTADTTPRTSQLVEVFEAALRGNTIAVLD
TGSGKTMVAVMLAREHARRVRAGEAPRRIVVFLAPTVHLVHQQFEVIREYTDLDVMMCSG
ASRVGEWGADHWKEEVGRNEIVVMTPQILLDALRHAFLTMSAVSLLIFDECHRACGSHPY
ARIMKEFYFGSQWRPDVFGMTASPVATKGASTLHNCEAHISQLELTLDAKIYIVEDRNEL
ESFSPPTTIVNKYYDAYMVDFDNLKSKLQIFSDEFDSLLVGLQESPSNKFKDTDNILETS
RKSLSRYHGKILYSLNDLGPIITSEVVKIHIESVKPLCDSEDCIFSKASLCLHMSYFKEA
LSLIEEILPQGYGELMKSESGSEELTKRGYISSKVNTLINIFKSFGSSNEVLCLIFVDRI
ITAKAVERFMRGIVNFSCFSISYLTGGSTSKDALSPAVQRFTLDLFRAGKVNLLFTTDVT
EEGVDVPNCSCVIRFDLPRTVCSYVQSRGRARRNNSEFILMIERGNLQQQEHIFRMIQTG
YYVKNCALYRHPNALSYDLSIQGMYTYQVQSTGATITADCCVNLIRKYCEKLPKDRYFMP
KPSFEVTIEDGLFKCTLTLPRNAAFQSIVGPLSSSSNLSKQLVSLEACKKLHQLGELNDH
LVPLTEEPMDTDFTTADEKCISGPGTTKRKELHGTTCVLALSGTWIHDSENITLNTYRID
FLCDQEGENYAGFVLLMEPELDDDVAPSKMDLFLIPNKMVYTTVTPRGKVQLNKKQLGKG
KLFQEFFFNGIFGRLFHGSRKSGAQRDFIFKKGHEIQWNTESMYLLLPLRDSSYIQDDLS
IHWEAIESCAGAVEQLWSSYQGDENVIPVNCIPQKRRGGQEEIIHLANKSLHCSSIKDSV
VLSLHTGRIYTVLDLILDTTAEDSFDEMCKGKASPFTSFVDYYHQKYGIIIQHPEQPLLL
LKQSHNAHNLLFSKLKYLDGSTGKPLLMEKEQIHARVPPELLIHLDVTTDILKSFYLLPS
VIHRLQSLMLASQLRREIGYNQHIPVTLILEAITTLRCCETFSLERLELLGDSVLKYVVG
CDLFLRYPMKHEGQLSDMRSKAVCNATLHKHGIWRSLQGYVRDNAFDPRRWVAPGQISLR
PFPCNCGIETAFVPSHRRYIRDDPSFFVGKPCDRGHRWMCSKTISDCVEALVGAYYVGGG
IAAALWVMRWFGIDIKCDMKLLQEVKFNASHLCSLSKINDIEELEAKLKYNFSVKGLLLE
AITHPSLQELGVDYCYQRLEFLGDSVLDLLLTRHLYATHTDVDPGELTDLRSALVSNENF
AQAVVRNNIHSHLQHGSGILLEQITEYVRSNLECQGKESEFLQHTTCKVPKVLGDIMESI
AGAVFIDTDFNVDMVWEIFEPLLSPLITPDKLALPPYRELLELCSHIGCFLNSKCTSKGE
EVIIEMSLQLRDELLVAQGHDRNKKRAKAKAASRILADLKQQGLSIKQCLSKAKQLDIVT
SDLQFDLTSSGTQLSYSDLNDYHILEGLSSVKKEVVLPLKMEKGGPRSALFKLCKILQWP
MPEFEFVEQRFRTPIVMDGATTTNFNSFVSTITLHIPDATTITFQGERRTDKKSAQDSAS
LMMLHKLQELKICICKT*

CDS

chr10:18360484..18360612 (+ strand) : 129 bp

chr10:18360689..18360865 (+ strand) : 177 bp

chr10:18360963..18361076 (+ strand) : 114 bp

chr10:18361567..18361701 (+ strand) : 135 bp

chr10:18361867..18361934 (+ strand) : 68 bp

chr10:18362679..18362745 (+ strand) : 67 bp

chr10:18362840..18362971 (+ strand) : 132 bp

chr10:18363100..18363252 (+ strand) : 153 bp

chr10:18363755..18363890 (+ strand) : 136 bp

chr10:18364519..18364624 (+ strand) : 106 bp

chr10:18364719..18364911 (+ strand) : 193 bp

chr10:18364984..18365144 (+ strand) : 161 bp

chr10:18365408..18365623 (+ strand) : 216 bp

chr10:18365913..18366178 (+ strand) : 266 bp

chr10:18366686..18366960 (+ strand) : 275 bp

chr10:18367052..18367560 (+ strand) : 509 bp

chr10:18367653..18367750 (+ strand) : 98 bp

chr10:18369154..18369362 (+ strand) : 209 bp

chr10:18369441..18369650 (+ strand) : 210 bp

chr10:18370078..18370554 (+ strand) : 477 bp

chr10:18370643..18370924 (+ strand) : 282 bp

chr10:18371091..18371417 (+ strand) : 327 bp

chr10:18371602..18371688 (+ strand) : 87 bp

chr10:18371770..18371845 (+ strand) : 76 bp

chr10:18371969..18372080 (+ strand) : 112 bp

chr10:18372185..18372383 (+ strand) : 199 bp

3'UTR

chr10:18372384..18372591 (+ strand) : 208 bp

FASTA

>Os10t0485600-01 class=Sequence position=chr10:18360484..18372591 (+ strand)
ATGGCCGACG ACGAGGCTGC CGTCCTCCCG CCCCCGCCTC CGCTGCCGCC GCCTTGCCGC CCCCACAGGC AGCTCCGCCC
GAGGGGGTCT CGACCGACTG CTGATACCAC CCCTCGCACT AGCCAGTTGG TCAGTGCAGC TTAGCTGATG TTGGCTGCTC
TCCTCGTTGG CGCCGCCTGC GTGCGTGCGT GCGTGCAGGT ACCAGGTGGA GGTGTTCGAG GCGGCGCTGC GGGGGAACAC
CATCGCGGTG CTCGACACGG GGTCCGGGAA GACCATGGTC GCCGTCATGC TCGCGCGCGA GCACGCACGC CGGGTGCGCG
CCGGGGAGGC GCCGCGGCGG ATCGTGGTGT TCCTCGCGCC CACCGTGCAC CTCGTCCATC AGGTTGCTTT TTCTTTTTTT
TTTTCATCAA CATGTGAACA AATGGAGTGT GGACGATGTG TTCTGATCGG GAGCTGGTTG CTCTGCATTT GTGCTGTAGC
AATTCGAGGT GATTCGTGAG TACACTGACC TCGACGTGAT GATGTGCTCT GGAGCATCGC GGGTTGGCGA ATGGGGCGCC
GATCATTGGA AGGAGGAAGT TGGGAGAAAT GAGGTAAGCG CCCGGGTTTA CTGAACCTGC TCCTGCGCTA TGCTTGAGGC
AGCGATTTGC TTGATTGCGA TGTACTGTGA ATTGGCACAT TTGGCGTGCC CACCAACTGA AGCCAGATGC AGGCTGAGGT
TGCTACCAGC CTACCCATTA ATAAATTTGA GAGTCATCAA CTTGATGTTT TCTGAAGGGG CGTGCATATG AAATACTAGC
TGATTTAGCA CTCTGGTTCA AGATGAATTT TCTTTCATGT GTTGTCATTT CCTAGATTGA GATGCTGGTC TGAATCTGAG
GGATATTGCA GTCCTACGCC ACTTTGTTCA AAGTAGCTGA AGTTCTGTAA CTTTGGGGTT CAATTTCTTA GATCCTTGCT
ATGTTAGTAC CTATCGGACT TAATTACAGC TACTGAATTG GGCTTACGCA TGCCATTGCT AACTTGGATC GGAAATACGT
GTTTACGCTG ACATTTGAGC GATGCATGCC TTTTGTGTTT CAGATCGTTG TTATGACGCC ACAGATACTG TTGGATGCTC
TGCGGCATGC TTTTCTGACA ATGAGTGCAG TGAGCTTGCT AATATTTGAT GAATGTCATC GTGCTTGTGG AAGCCATCCA
TATGCACGAA TAATGAAGGT AATAGAAATT TGGGGATCTG TCTTTTGCTT TGACAACATT GGTAGATAAG CTTTGGCTTG
CAGTTTTTGT TATTACAGAA AGTTGCTTAG GATAACAGTA TTTGTTTTAA TAATCTGACA TGGCAAATTT GCTTTTGTTT
TATGTCTCTC TTGAGTTCCA AAGGAATTTT ATTTTGGGTC TCAGTGGAGG CCAGATGTAT TTGGAATGAC AGCCTCCCCC
GTTGCTACTA AAGGCAAGAA TTCTACACAC GACAATCATG TGCTTTTTTG TAACGAAAAT AGTCACGTGC TTTTAACCCT
GTGTATATTT CATTGATCAA TAGTTTCAGA AAATGTGTTT TAGCTTTGTT ATTAAAATAA GCATGTCGTG TGACTGTTAT
TATCTTCCTT TTTGAAGAAT GCCCCAACTG CCATGTACTG TCAAAAACTC ATGTGATGTA TTTGAGTGCT TTTGCCTTCT
TCATAACAAG ACAATACATT TCTGGAAGTA TGATTCTTTC TCTTGCTTCA TAATTCTACA TGGAATACCT CTCTGCCTGC
CAACTGTAGA TTGCATCCTA TTTCAAATTT TGATGATTGG GCATCACAGT TTGCGTGTTT GACTTAGTTG TCCACTAAAA
GGCGAGTTCC TTAGAGGGTC GCTTACCCTG GTTGGGTAAG GTTAGGTCGT GTGAGCCTTT TGTTTTGTAA GTAGTTTTTT
CGTAGGTGTT TTTGGGGAGA AAGGCATTCT AGTCTCTTCC CCGTTTTTAT TCCTTCTTAA TGAAATGATA CACATACTCA
TGTATATTTT TTTAAAGAAA AGGTTGTCCC AATTTAATCT ATTCAATGCT TCTACTCATA TTACTGGAGA GCACATTCAA
TCAGTTCATT AAATTGAAAC AGTTTCCTGT TGTAGAATAA TTTCATTGAA ATTATGAATT TCTAATATTG TTCGGATTTG
CTGGCTCATA ATCTATTACA ACCCTCCATT TTTTCAGGTG CTTCCACACT ACACAATTGT GAAGCACACA TTTCTCAACT
AGAACTAACC TTGGATGCCA AGGTTATCTC AAGCTGACAA GCTTTGGATT TATTGAATTT TAAGAAAACA ACTTTCCAGT
AACAAATAGC CTGTCATATG TTACATGCTA TTGCAGATAT ACATCGTAGA AGATCGAAAT GAGCTTGAGA GCTTTTCCCC
TCCTACAACA ATTGTGAACA AATACTATGA TGCTTACATG GTTGATTTTG ATAATCTGAA ATCAAAGCTT CAGATATTTT
CTGATGAGGT GATTTAACTG AAATACATTT GAGCTTATTA TTAAAATACA TATATAATTT GGAGTACCAA AACCTACAGC
TCCCTGTAAC TTTCTTTTTG CATGTATATT TGTTTAAATT TTGTACTGTT GGGCAGTTTG ATTCTTTGTT GGTTGGTCTT
CAAGAATCGC CATCTAATAA ATTTAAAGAC ACCGATAATA TCCTAGAGAC TTCAAGAAAG AGCTTGTCCA GATACCATGG
GAAAATATTG TACAGCCTAA ACGATCTTGG TCCAATTATC ACCTCTGAGG TATTGCATTA TCCAATCAGT ATTATATAAT
CAGTTCTATG TAAAGAAAAC TTTTCTGAAG AGTCACATAA CTTTGACATT TCATATCGGC CTTGTTTGTT TACTAGTTAT
ACCTACATAA ATTCCAGTCT TATTGAAATG ATTTTTAACC TTTTTGCAAA TATATAAAAT ATTGCGCATG CCGAACTGAT
AAATCAAAAG AATATTTGGT GAATTCTTTT CATAGGAACC ATTCACTTTA ACTAGTAAAG ATTGGCACAA GTTCAAGTAC
CTAAGAACAT AAGCTGCTTT GCATGACCTT GCCTGTGACA GCTATAGTAT CTTTGCCATT ATTTTTCCGT AACATCACGT
GTGCTGCAAC TGTTTGTCTT CTGTTATGAA AGAGTGCTTT GTTCTTTTCT GGAAGTGGAA ACGGTGTATT GGTACTAAAA
AACCTGTTAT CCATAAGGAC TTCAAGTATA GTGTAAAATG CTTATACTAA CTTAAATTGT TTTCTTAACA GGTAGTCAAA
ATACATATTG AAAGCGTTAA GCCATTATGT GATTCTGAAG ACTGCATTTT TTCTAAAGCT AGCTTGTGCT TACATATGTC
TTATTTTAAA GAAGCTTTAA GTCTAATAGA GGAAATTCTT CCACAAGGTA TAGTGCACCC TTTAGTTGTT ATCTTGAATT
AACTGCATAA GCAAAAATGA TGCAGTGAGT ATCTTTCTTT TATCTGTATG GATTAGGTAA TGACACAATT TGCAAATCCA
ACTAGGATTG CATTATGTTC TTTCTGTTTA GCTTATGCCC TCCAGTAAAA GATTCCCTGA ATCTTATTAG TTTAGTTGTC
TGTTTTTTGT ACGTTATTCT CAGAATAAGA AGAGAAACAC ATGCTTCTAC ACACCCTCCT AATTTGCATG CTCTATAGAA
GTGAACTATG AAGTTGATGT AGTTCGCTGG GTGCTGCTAG CTAATTTGTG GAGTTGGCTG CTAGCTGAGA GGGCTATCAC
CTTTGACGTT AATCTTTGCC CCTTATGATA AGATCTGGTC AGCGGGCTTC TGCCGGTTTG GCAAAAAAGA AGTGAGCTTT
GAAGCAGTTT CCAGTAGGTA GTTAGAAGCA CTCAACCAAA AAGACAGAGG AGATTGACTC TAACCTCTAT AGCCACTTAG
ATTGCAGTTG GTAGTCTCTG TGCCACAGCT ATTGTTTCTC TGTATGTGTT CCTTTTTCTA CTTTCGTGCA TTGATAGTTG
CCTTCTCTAA TTCTGCTGAT GCAATTGCAT GACAGGATAT GGTGAACTAA TGAAATCAGA ATCTGGTTCT GAGGAATTAA
CTAAAAGGGG ATACATTTCT TCAAAAGTGA ATACGCTAAT CAACATCTTC AAATCGTTTG GGTAATACCC TAGTATTCTA
CTCAAGATGT TTAGTTTCAC CTACTTTTGG TCTTTTGTTG GCCAAAAATA ATACAGCCAT GTGTTTTCTC TACAGGTCAT
CAAATGAAGT GCTTTGCCTA ATTTTCGTAG ACAGAATTAT AACAGCTAAA GCCGTCGAAA GGTTTATGAG AGGAATTGTT
AACTTCTCTT GTTTTTCAAT TTCTTACTTG ACTGGAGGGA GTACATCAAA AGATGCTCTG AGTCCAGCAG TTCAGAGATT
TACTTTGGAT TTGTTCCGAG CTGGAAAGGT ATGAGATGCT ATTGTAAATT TGATTCAAAC AGTCTTTCAA ATGTTACATT
AACTTCACAT CAATTTCTAG GTGAACTTGC TTTTTACAAC AGATGTGACT GAAGAGGGCG TCGATGTACC TAACTGTTCT
TGTGTGATAC GCTTCGACCT ACCCAGAACT GTTTGTAGCT ATGTCCAATC TCGTGGTCGT GCTAGAAGGA ACAACTCGGA
ATTTATTCTT ATGATTGAGA GGTGAATCAT CACACTTGAA ATTAAGTTAC CCTGTGACAG AGATAGTCAA TTTTTTCTAA
CCTAAATTCA TTTTCCACAT TTTATGTGTA TAAGTTAGAT CCAAGCTACG CAATTATGTA TTTGTGAACA GTCTGAGCTC
CTAGGCCCAA AATTGCTTAA TCCTACCTAT CTCAGTAGAA AAAAAGTATG CCCGTGTTTA ATAATTGGCA TAAATTTTTA
TGCCATTTTT TTCGCTTGTT GATCTTTCAT ATATGGATTT TCAGGGGAAA CTTGCAGCAG CAAGAACACA TATTTCGTAT
GATACAGACT GGTTACTATG TTAAAAACTG TGCACTCTAT AGACACCCCA ATGCTTTATC CTATGACTTG TCTATCCAAG
GGATGTACAC CTACCAAGTT CAGTCAACTG GAGCAACTAT AACCGCAGAT TGCTGTGTCA ACCTAATTCG TAAATACTGT
GAGAAGCTTC CTAAAGATAG GTACACTTAA CACTCTAGTA TTTATAACTC TCGTTGTTTT ATGAGTTGCT TGTGCTTCAG
TGAGTATCTC TTCTTCCTTT CCTGCTGATT AACATTGCAA CTTATGCATG AATCATTGAT GGTATCCTTA AGATTTATTG
ATATACTGCT TGACACCAGA TGCATGGATA GCTGGTTAGA TTCAAATCAC ACATAGACAA AAAAACATCC CTGCTACTTC
CCTAGGCATG ATTTGCTGTC CTAGTTCCAT TTCATTAAAG TGGTACTTCA TGGTAACATC CTTCTGCAGG TATTTCATGC
CAAAGCCTTC CTTTGAGGTG ACCATTGAAG ATGGATTATT CAAATGCACA TTGACGCTAC CTCGAAATGC AGCATTTCAA
AGTATAGTTG GCCCTTTAAG CAGTTCAAGT AATTTATCCA AGCAGCTTGT ATCCCTAGAG GCCTGCAAGA AATTGCATCA
ACTGGGAGAA CTTAATGATC ATCTTGTACC TTTGACTGAA GAACCTATGG ATACAGATTT CACTACAGCA GATGAAAAAT
GCATATCTGG ACCAGGTATG AGTGTAATGT TGCAGTTTTG CTTATATTAT ATTTCTTGGA TACACCCATC ACTTCATATA
TTTTTCTACG CTGTAGCACT GGTATATTTT ATAAACTATA CAATAGTACA ATACTATGGT TCTTCAGAAC AGATCTGGGT
TGCCATACAA CACTGAAAAT TGTAAAACTA GAACTACCTC GGCTGTCTCT TTACGTTTCC TTTGCAATGT AGCTATTTAT
AGAGATACTC TACACATATG GTGTTTTATT TTTGGACATG TTTGTTGGAG CAAATACCTC CTGATGCTTG AACTCTGTTG
ATCTTGCAAT TACGTAGTTA CTCTCCCTTC ATTTTGTTAC TTTATCATTT GTTTGAGAGG TTCCCGCATA CTGTAGTATG
GCAATTGAAA GTTTTAAACA GCAACCCTAA TCTTCCCATA TATTGAAATT TTCCAACAGA TATGAGTGTT TCTCCTATTG
TACATGATCA CTAATTTTCC ATTCTCTTTC CTATTTTTGC AGGAACAACT AAAAGGAAGG AGCTTCATGG TACTACATGT
GTTCTTGCTT TATCAGGAAC TTGGATTCAT GACAGTGAAA ATATTACACT GAATACTTAC AGAATTGATT TTCTTTGTGA
CCAAGAGGGT GAAAACTATG CTGGGTTTGT TCTCTTAATG GAACCAGAAC TTGATGATGA TGTGGCACCC TCAAAAATGG
ATCTGTTCCT GATCCCTAAT AAAATGGTCT ACACCACTGT AACTCCTCGC GGAAAAGTTC AACTAAACAA AAAGCAGGTA
GTTCAAGAAT TAGTGGCTTA TTGACATTCT CGTTGCTAAA ATTCCATATA GTTTTTATAT CTGTGACTCA TCTTTCTTGT
TTCTTCAGTT AGGTAAAGGG AAATTGTTCC AAGAATTCTT TTTCAATGGA ATCTTTGGTA GATTATTTCA TGGTTCTCGA
AAAAGTGGAG CACAAAGGGA TTTTATTTTC AAAAAGGGTC ATGAAATACA GTGGAACACG GAAAGCATGT ACTTGCTTTT
ACCTTTGAGG GATTCTTCAT ATATCCAGGA TGACCTAAGC ATACACTGGG AAGCAATTGA ATCTTGTGCT GGTGCAGTTG
AGCAGTTGTG GAGTTCGTAT CAAGGAGATG AAAATGTCAT TCCTGTAAAT TGTATTCCAC AAAAAAGAAG AGGGGGCCAA
GAAGAAATTA TTCATCTGGC CAATAAGTCT CTTCATTGTT CCAGCATCAA AGATTCAGTC GTGCTATCAC TGCATACAGG
AAGGATATAC ACTGTTCTTG ATTTGATCTT AGACACAACT GCAGAGGACT CGTTTGATGA GATGTGTAAG GGGAAAGCCT
CACCTTTTAC TTCATTTGTG GACTATTACC ATCAAAAGTA CTTCCTCTTT TTTATATATA TATTTATTTC TAGTACTGCT
CTGCTCTTGT ATGTGTCCTG ATGAACTTTC TTTCTTCACT TCATTGTAGG TATGGTATTA TTATTCAACA TCCAGAACAA
CCACTATTGC TGTTAAAGCA AAGCCACAAT GCACACAATC TTCTCTTTTC AAAATTGAAG TATCTAGGTA CTGGATACAC
ACCCTACTCT AGTAACCTTT ACCTCTGTTA ATGGAAAGTT TTAGCTGAGT GTGGGCTCAC TGCACCTGAT ATCCATGCCT
TGCAAATTTC ATTGGGATAA GAGCACAAAT TGTGTCTTTT ATCTTTAGTT TTGGTTAAAT ACTAGACCTC AACTTTTCAT
TTATTGACAT ACACTAGTGA TTGTTACTCC AACATGCTGT TCTATGCTCA CCCTCTTTTG GCCAGGAACT ACATGGCCAG
CAGTTGGAAT AACTTAAGTG AAAAAATCTA TCCGAAAAAA GGCTTGAATG CTAACATTAT ATTCTTGATG TTGACTTAAT
TTAACATGTT TGGCCACCTG TATTATTTTG GATAGATGAA TCAGTTCAAT GAGATAGCAA AGAAACTGTT TGAGAAAAAA
AAAGATGGCA AAGAAACAAA TTTAATACTA CTTTTTTGTG TTTTCTTAAT ACAACCATAT GGTACTACTA AAAAATTATC
AAATAAATTA TAGTACATGA CACAAAACAT GGAATCCTCT CCTTTATTTT TCCATTTCCT TTTGTGTGCG CTTCAGGTTA
TGCTGGTATC CCAACAGGAA CTTTGTAATA AACTATATTT GCTTTCTACA TGAGCAGGGT AATTTCCTTA ATAAATCGAT
GTAGTGTCAT TGTGTCAAAA CCAGCAATAG GAGTCCTTAA TTACTTTATT TTCTGCACAC AATTTGATTA ATGCATACTA
ATTATTGATA GTGGAACTAT TGCATTCATC CATTCATGCA GTTGAGCCAC ATTTCTTTTC CAGCATATAC CTTTTCTTTT
GCATCATCAA TCCACCTCAT AGAGCAGTAG AGTCCTTCTT TTGTTACCCT TTGTCCGAAA GTACACTAAA TTTGTAGGCC
TCTTACTATT TCGAGAACTG CAAATCAATA TGACTGTCCA CCCTTATTAT TACTGTATCC CAAGCAACAG GACTGAATCA
ATGGCTCTAG TGGttttttt tttagataat gggcagcgcc cggcctctgc atcataaggt gaatgcacac ggccaatata
GCGTGGCTGG CACAAAAGGG CTTAGCATCT TATGGCCTTG ACACCTGTAC CATCGTAACA GTGGTCGTTT GCTGTTGATT
TTTTTGTAGA TTTCAGTGTG TTAGTTCCCT TTTGGGGGTG TGTGTTTTTg gtggtctctt ggtgttgtag tccattggga
cctttttctt ttccttctca atataatgat gagcagttct cctgtgcatt caagagaaaa aaaTGCAAGA TACAGCTGCG
AGCCTGCGCC ACACTCAGCA TATCTTCACT TCTAGTATAA TGATATGCAA GATAGCAGGT ACAGTACTTT GGGTCTTATT
TGACATGAAA TTCCATATGA CCTATGGCAG ATGGCTCCAC TGGCAAACCT CTGCTCATGG AAAAAGAACA AATTCATGCT
CGGGTTCCAC CTGAACTACT TATCCATCTC GATGTAACAA CTGATATTCT GAAGTCATTT TATTTACTCC CTTCTGTAAT
ACATCGGCTT CAGTCACTTA TGCTAGCCAG CCAGCTTCGC AGAGAAATTG GTTACAATCA ACACATACCA GTCACTTTGG
TTTGTTCTCT TTCAACATTT TTATTTGCTA AGGATGACTA TGCATTTATC AATAATTTGG TATATTTTTC ATGTTAGATT
TTGGAAGCTA TAACAACTTT AAGATGCTGT GAGACATTTT CTCTGGAGCG TTTAGAGCTG TTAGGAGACT CCGTGCTAAA
GTATGTGGTA GGATGTGACC TTTTCCTAAG GTATCCTATG AAACATGAAG GTCAGCTCTC TGATATGAGA TCCAAGGCTG
TCTGCAATGC TACACTTCAT AAACATGGAA TATGGCGGTC GTTGCAGGTA GATGATTTAC ACCCCTAAAT GCATTTACAT
GGTTTCAACT TCCTGAAGTT TGCAATATTT CTGTTGTTGT ACAAATAAAT TTTTTAAGTT ACTTAATTTG GTATGGGCAA
TTCACCTACT TGAGCATGAG AGACTACGGA TTGTATATGC ACATTGTGTA GCAAGTATTT GCTTCTATTT TTAGCTTTGA
TTTTTGCATA AATGCACTGG TGGTCATATG TTTGCCATGA TTGCTCCTTT CACATTGTTC CTTTCATAAC TTTCTTTGAA
TGCCTATGCT TTACTTACTG TTCTATCAAT CTTTAGTTTC ATAGTCACAT CATAGGCTTG GGCAATATAT ATATTCAAGA
ATATTTTCTA ATTCTTGTGC TTTTTTTTGT GAGCTTTGCT TATGTTTACA GATTTTTTTT TATCATACTT TCAGGGTTAT
GTACGTGATA ATGCTTTTGA CCCACGGCGT TGGGTTGCTC CTGGACAGAT ATCGTTGCGC CCTTTTCCTT GTAACTGTGG
AATCGAGACT GCATTTGTTC CTTCTCATAG AAGGTATATC CGAGATGACC CATCTTTTTT TGTGGGAAAA CCATGTGACA
GAGGTCATAG GTGGATGTGC TCAAAAACAA TATCTGATTG TGTTGAAGCA CTGGTTGGAG CATATTATGT TGGTGGTGGC
ATTGCTGCTG CACTTTGGGT TATGAGGTGG TTTGGAATCG ATATCAAATG TGATATGAAG CTATTGCAGG AAGTGAAGTT
CAATGCATCT CATTTATGCT CCTTATCAAA AATAAATGAC ATTGAGGAAC TGGAAGCAAA ACTGAAGTAC AACTTCTCAG
TCAAGGGCCT TCTTTTGGAA GCCATAACTC ATCCATCTCT GCAGGAATTA GGTGTTGATT ACTGTTACCA GGTTAGTGCA
ACAGAGTAAT TATGTTTTGT GTTAGAATCA AAAGTTTTGT GCCCCCCTCT TTTTTTTTTC TTATCTGCTT TCTATTCAGC
GTCTTGAATT TCTTGGTGAT TCTGTGCTGG ATCTACTTCT TACACGTCAT CTCTATGCTA CTCATACTGA TGTTGATCCT
GGAGAATTAA CGGATTTACG CTCCGCTTTG GTTAGTAATG AGAATTTTGC ACAAGCAGTT GTAAGAAACA ACATTCACAG
TCATCTACAA CATGGATCCG GAATACTTTT GGAGCAAATT ACTGAATATG TCAGGTCAAA TTTGGAGTGT CAAGGGAAAG
AGAGTGAATT CCTTCAACAT ACTACATGTA AAGTACCTAA GGTTAGATGC AGTATTCTTT GTTCATAGTC TTGATAGCCT
AGTTTCAAGT TATGTGTTTT CTCTCTCTCT TTAATGTCTA ATTCTCAATA CTTAGCTTTG CGGAGTGTAT CACCAGACAA
TATTATGATT ACATGTTATC AACCTAATTT TGTTCTGTGT TTTACAGGTT CTTGGTGACA TTATGGAAAG CATCGCTGGT
GCAGTATTTA TAGACACCGA TTTTAATGTT GACATGGTTT GGGAGATTTT CGAGCCATTG CTTTCTCCAC TGATTACACC
TGATAAGCTT GCATTGCCAC CTTACCGTGA GTTGCTGGAG CTATGCAGTC ACATTGGTTG CTTCTTAAAT TCAAAATGCA
CCAGTAAAGG AGAAGAAGTA ATTATAGAGA TGTCACTGCA ACTACGAGAT GAGCTGCTGG TAGCACAAGG GCATGACAGA
AACAAAAAGA GGGCAAAGGC AAAAGCAGCA TCTCGTATTT TGGCAGATCT TAAGGTAAGA ATTTGTAAGA AGAAACAAAA
AGTGTACACA CATATGGGGT TGGCTAGTGC CTCGTAGTGT AATTGATTGG CCGGTTGAAT GGCAGCCCAA GTACACCTTG
AGCCTTGAGG TGTTCATATT GCTAGTTTGA AAATAGATGC TTATTTATCC TACAAACTGA TGTTCGATTT TGAAGCAGCA
ACAGGGTCTT TCAATTAAAC AATGTTTGTC CAAGGCTAAA CAGCTGGATA TCGTGACTTC AGATCTTCAG TTTGACTTGA
CAAGTGTAAG ATTCTAGACA GCACTCCACC AAACGCCTTA TCAAAGTATT GAACTTATTC TGAATAATAT ATTTGATGTT
GTGTAGTCAG GAACACAACT CAGTTATTCT GATTTGAATG ACTATCATAT CCTAGAAGGT CTTTCCTCAG TAAAGAAAGA
AGGTTTGCGC ATTATTTATT GTCTTTTGGT TCAATTGTTG CTTGCTGGCT TGCACCTGTC AAACAGGAAG TACTAAAATT
TAGGTAAATT CTACTGAAAC CATATGCCAT TCGAAATGTT TTCAGTTGTG CTTCCACTCA AAATGGAGAA AGGTGGACCT
CGAAGTGCGC TTTTCAAGCT ATGCAAGATT TTGCAGTGGC CAATGCCAGA ATTCGAATTT GTGGAACAAA GGTTCAGGTA
TGTACAGGAA TACCAAGAAA TTCTTTCAAG AAATGCAAAA CTTGAATAAA CTCAAACGAT CTTCATGATG TCTTGATTGA
TGCACGTGGT TGCTGCAACA GGACTCCTAT TGTTATGGAT GGGGCGACAA CAACAAACTT CAATAGCTTT GTTTCGACAA
TCACCTTGCA CATACCTGAC GCAACAACCA TTACATTTCA AGGTGAGCGA CGTACTGACA AAAAGAGTGC TCAGGATTCA
GCATCCTTGA TGATGCTTCA CAAGCTTCAA GAACTCAAGA TCTGTATATG CAAGACTTAG CAAAGCATCA TTGAGACATG
GGCCAATATG CCAGTTAACG ATTGCGACTA GCTAATGCGA GCTACTTCCC TCCCAAAGTG AGATGCGACG AAAATATTTC
TGAAAAGCTC GATGCTCCAG ACTGTCACTG ATCCTATGTT ATTTTGGGGA AGAAGATCCC TATGGTATAC TACCTTGCAT
TACCTGGATA CATTGTTGTC GAGTTTCC

Locus: Os10g0485600

Loading...

Locus: Os10g0485600

Loading...