Os10t0486900-01

Locus

Os10g0486900

Description

Tetratricopeptide repeat protein, Blast disease resistance

RAP-DB Gene Symbol Synonym(s)

OsTPR1

RAP-DB Gene Name Synonym(s)

tetratricopeptide repeat protein 1

CGSNL Gene Symbol

TPR1

CGSNL Gene Name

TETRATRICOPEPTIDE REPEAT PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsTPR1

Oryzabase Gene Name Synonym(s)

tetratricopeptide repeat protein 1

Transcript Evidence

AK063937

Protein Evidence

Q7XD86

Literature

PMID: 30610168

Note

Manual Curation

October 11, 2019

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide-like helical domain superfamily (IPR011990)

Tetratricopeptide repeat-containing domain (IPR013026)

Tetratricopeptide repeat (IPR019734)

Tetratricopeptide repeat 1 (IPR001440)

Tetratricopeptide repeat 2 (IPR013105)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

001-123-D11 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0486900-01)

RiceXPro (AK063937)

Others

Oryzabase (23007)

KEGG (Os10t0486900-01)

Transcript

1178 bp

>Os10t0486900-01 Tetratricopeptide repeat protein, Blast disease resistance
GGGACCCCGAGCCGATCGATCGATCGAATCGAATCCCCCGCCGCCGCCGCCTCCTCGCCG
TCGAGCTCGACCGCGCCGCCGCGTTGCCCCCCTCTCCTCCTCCTCCCCCGGCGACGCGTC
GGTCGCTGAGGGAGCTTGTCTTGGTGCTCGCCGCGTTAAACCCCGCGAGGCGGCGAGCAG
GGGCTGTGATGGTGGTGATCGAGCAGGAGCCGGAGGTCGAGGAGACGCCGGCGGCGGCAG
AGGAGCCGGCTGccgaggagcaggcggcgggtggtgcggccggaggggaggcggcgaggg
cggatggggaagacgaggaggaggccttcgaggacgcgctgaccgacgagcagctccggg
agAAAGCTAGAAGCCAAGCAAATGATGCAAAGGCAGAAGGGAACAAGTTTTTTGGTGCTG
GAGAATATGAGAGGGCATTGTCGCAATATGAGACAGCTTTGCAAATTGCTGCTGAGCTGG
AATCTGCCGAAGACATACGCTCCGCATGTCATTCAAATCGTGCTGTATGCTTCTTGAAGT
TGGGCAAATATGATGAAACAATCAAAGAATGCACCAAAGCACTTGAGCTGAATCCTTCAT
ACTTGAAAGCCTTGCTCCGGAGGGGAGAAGCACATGAAAAGCTTGAACACTATGATGAAG
CTATTGCTGATATGAAAAAAATTATTGAGCTGGATCCTTCAAATGAACAAGCTAAGAGAT
CACTGTTCCGACTGGAGCCACTGGCAGCTGAGAAAAGGGAAAAGATGAAGGAAGAGATGA
TCGGAAAGCTCAAAGATCTGGGGAATTCTGTGCTCGGGCGCTTTGGGATGAGCGTCGACA
ATTTCAAAGCTGTTAAAGACCCAAACACAGGCTCGTACTCCATTTCGTTCCAGCAGTGAC
GACATGGGGTAGTAACGAGTTGTTTAAATGAATATGGACAAGTACACATGCAGTCACTGT
AAATCCTGGAATGCTAATGTCATTTGGTTCAAAAACTTTGGCCCTTTTGTATCAATAGGT
TTGTTACCATCGCCCGCAGTTAAATCTGAAGATGGTGCATGGACGTTTGCAGTTATGTTC
TGAGAGAGGTGGTTTAGATGAGTGAACTTGTATTATAGGCGTTTGCCACGCTGTGATTCT
CTTCATTTTATCATAGCAATTCTTGTTTGCTTGAACAT

CDS

711 bp

>Os10t0486900-01 Tetratricopeptide repeat protein, Blast disease resistance
ATGGTGGTGATCGAGCAGGAGCCGGAGGTCGAGGAGACGCCGGCGGCGGCAGAGGAGCCG
GCTGccgaggagcaggcggcgggtggtgcggccggaggggaggcggcgagggcggatggg
gaagacgaggaggaggccttcgaggacgcgctgaccgacgagcagctccgggagAAAGCT
AGAAGCCAAGCAAATGATGCAAAGGCAGAAGGGAACAAGTTTTTTGGTGCTGGAGAATAT
GAGAGGGCATTGTCGCAATATGAGACAGCTTTGCAAATTGCTGCTGAGCTGGAATCTGCC
GAAGACATACGCTCCGCATGTCATTCAAATCGTGCTGTATGCTTCTTGAAGTTGGGCAAA
TATGATGAAACAATCAAAGAATGCACCAAAGCACTTGAGCTGAATCCTTCATACTTGAAA
GCCTTGCTCCGGAGGGGAGAAGCACATGAAAAGCTTGAACACTATGATGAAGCTATTGCT
GATATGAAAAAAATTATTGAGCTGGATCCTTCAAATGAACAAGCTAAGAGATCACTGTTC
CGACTGGAGCCACTGGCAGCTGAGAAAAGGGAAAAGATGAAGGAAGAGATGATCGGAAAG
CTCAAAGATCTGGGGAATTCTGTGCTCGGGCGCTTTGGGATGAGCGTCGACAATTTCAAA
GCTGTTAAAGACCCAAACACAGGCTCGTACTCCATTTCGTTCCAGCAGTGA

Protein

237 aa

>Os10t0486900-01 Tetratricopeptide repeat protein, Blast disease resistance
MVVIEQEPEVEETPAAAEEPAAEEQAAGGAAGGEAARADGEDEEEAFEDALTDEQLREKA
RSQANDAKAEGNKFFGAGEYERALSQYETALQIAAELESAEDIRSACHSNRAVCFLKLGK
YDETIKECTKALELNPSYLKALLRRGEAHEKLEHYDEAIADMKKIIELDPSNEQAKRSLF
RLEPLAAEKREKMKEEMIGKLKDLGNSVLGRFGMSVDNFKAVKDPNTGSYSISFQQ*

5'UTR

chr10:18420721..18420908 (+ strand) : 188 bp

CDS

chr10:18420909..18421082 (+ strand) : 174 bp

chr10:18423599..18423778 (+ strand) : 180 bp

chr10:18424245..18424371 (+ strand) : 127 bp

chr10:18424508..18424621 (+ strand) : 114 bp

chr10:18424975..18425090 (+ strand) : 116 bp

3'UTR

chr10:18425091..18425369 (+ strand) : 279 bp

FASTA

>Os10t0486900-01 class=Sequence position=chr10:18420721..18425369 (+ strand)
GGGACCCCGA GCCGATCGAT CGATCGAATC GAATCCCCCG CCGCCGCCGC CTCCTCGCCG TCGAGCTCGA CCGCGCCGCC
GCGTTGCCCC CCTCTCCTCC TCCTCCCCCG GCGACGCGTC GGTCGCTGAG GGAGCTTGTC TTGGTGCTCG CCGCGTTAAA
CCCCGCGAGG CGGCGAGCAG GGGCTGTGAT GGTGGTGATC GAGCAGGAGC CGGAGGTCGA GGAGACGCCG GCGGCGGCAG
AGGAGCCGGC TGccgaggag caggcggcgg gtggtgcggc cggaggggag gcggcgaggg cggatgggga agacgaggag
gaggccttcg aggacgcgct gaccgacgag cagctccggg aggtagtgcc ttgGGGCGTC CCGTCCACTC GATCCCCCTC
CCTATCTCCG TTCTCGCTGT TGCCCCGAAC TGCTGTACCT AAATCTTAGG GAAATCTGGG GTTCCGATGG TAGCAGCAGT
AACTTCTATT AGTCACCGAG GGTTTTGTGG GGATCGATTT TTTTCCCTCT ATCTGGGGGA GTTGAGATGG AAGAATAGAT
TGGAAAATTT CTGATTACTG CCGAGAATTC CACTGGTACA CTTGGGTTTA GGGCAGGTTT GGTTGTGGAT AGGGATGTAC
CCCCACTTCT TCATTTTAGC TTCTTTAGAG TTAATGATGT GAACAACTAG ACTACTAGAG TACGGTGCAA GGGTTAGTAA
ATGGGCTATG GTCTAATGAG GTTGTTTAGT GCTAATTCCT TTCATATCCT TGCGGAGAGA ATTTCTATTT TCGGCCAATC
TGTTACTTTG TGCAGTTATT AATATGCATT TTCGTAGCTG GCTCTCTTGT TTATGAGGTT TTTACCTGCG TGCCATTAAA
AAAGATGACC CCTGCCTCTG TGCCACTAAA AAGTTCGAGC CTCCCTCTAT GTCATCGTCG AACTTTATCG CGCCCTCCAC
ACCACTCCGT CGCTATTCTG TTTGGGTTTA ACCGTTTGGC AGCTTTGACA TGTGGGCCCA TGCAGAAAAA ATGTCGCTCT
TGCCCTTCTA GTCTCTGCTT GCCTCAAGTG CGCCACAGAG AGAGAGCGCG AAGGCGACGC GGCGGCGGCC GACGCAGTTG
AGTGCGGCGG CATGGCAGCA CGGTCGTGCG CACAGGATGA AAGGCGAGCC AGCACGGCGG TCAAGCCGCG CAGAGAGAGA
ACGGCGCCGT CGCAGCCGCC GAGCATCGGA CCCACGGCGC CGTCGCAGCC GCCGAAAGAG GGCGTGGAGG GGTACGGGTT
GGCAACGGCT GCACGCCCTC TTCCTCGCCT CCACTTCACC AACATTGCCA CCGCGGCTGC TCCCGATTTG CGGCGACGGG
CGACGATGGC GGCGAAGCTC TTGCTCGCGG CGGTCACCGT GAAGCTCTCC CGTTGACCTC GTGCAGCGGC ACAGGTTCCC
GGCCACCGCG CGCTCCGCCT CGGCCGCCGT GAGCCTCGAG AAGCCCTCCG CGGCGGCCCC AAACAACAAT CAATCTCCCT
CCATTGCATT GCGGTTCGAA TCGAATCGAA TTGAAGATAT TTCGTTCTTC TTCCCTATTA GCTCTTCCTC CCGCTCGTTC
AGCTTGGATT GAACATCCAT TCAGAGTTTG ATTGTTGTTT GTTTCAATCC AATTAATCCA TCCAGTTTCC TGTCGATTTC
ATGCGTGATG AAGTACTAAT CGAAGCAATT TGTTTCCCAC GCCGGCTGCT CCCGAGCCCC TCGGTGGTTG TCACCGCGCA
GTGGTGGAGG CCGTGCACCA GCGTGAGGCA CGAGTTGACC GCCGCGTGCG TCACCTCGTC GACCTCCGCG TCGTACGCTG
AGACCACCAC CACGCACGCC CGCAACCACC TGTAAAAATA CCAAAACCGA GAAACCATCA AGCTCGCTCG CCGAAGCCGA
TCGAACGGAA GCAAAGCAGC CGAGGAGGAA GGGGAGATGG TTTGTGTTGC CTTGCCTTCG CCACAGCCGA GCTTGGCACC
GGTGAACCGG GTGCGGGAGC GGAGGAACTC GAGGAGGGAC TCCCTGGGGT CGCCCCCGTT GCGGCGAAGC TCGAAGCGCT
CGCCGTTGGC TGCGGCGGCG AGCCGGCGAC GGCGAATCCA TGGCGGTGGA GGAGGAATCC GATTCTCATC TAGCCCCATT
TCACACTCTC CCCTATCTCT CTAAGGGCAA ATAAGTCATT TGGCTGCGCG GTCACACACC GTTAGGACCA AAAACGAACG
GAGTGGTGTG AAGGGCGCGA TAAAGTTCGA CGATGGCATA GAGGGAGGCT CGAACTTTTT AGTGGCACAG GGGCAGGGGT
TATCTTTTTT AATGGCACAC AGGTAAAAAC CTCCTTGTTT CTACGATGGC GTGATTCTGT GATCTTAAGG TCTTATTAGG
TGATTATTTT GTTCTCTCAT TCTCTAGTTT GGAACAGTTG CAATCAGGGC GGTTTAACTG CAATTGTTCA TATGCATATG
AGATAACACA AAGTTGGTGC TTAAGAAGTC GTGTGGTAGT ATTATGTGCT AGGTAGAACT AGTGCTTGAT GCTTCACTTG
CTGTCCCAGT TTCCATAGCA GTTATCCTTT TTGCAACACA AGTATCACCT GGTTCTGACC CTTGACAAAT ACAAAGCTAG
GTACTAGCAC CAAACCGACA ACTAAAATTT GTTGTTATGA TAGATTAGCA GTCTAGTTCT AGCTGCTAGC CGCTACATGC
TAAACAGTAA TTAGATTCAC CAGTTTATAG TTTCTAAATG GACGTTATTG TTTGGACCTT GTTGACATGG TTGGGATTAG
ATATAACTTG TATGTTGGTG AAGAGATTTA TAAGCTTATT GCATTCTGAT AAATGATTGT GCTTCCTACT TCCTGTAGAA
AGCTAGAAGC CAAGCAAATG ATGCAAAGGC AGAAGGGAAC AAGTTTTTTG GTGCTGGAGA ATATGAGAGG GCATTGTCGC
AATATGAGAC AGCTTTGCAA ATTGCTGCTG AGCTGGAATC TGCCGAAGAC ATACGCTCCG CATGTCATTC AAATCGTGCT
GTATGCTTCT TGAAGTTGGT AAGCCTTTCT ATTGGTCTTT AAATATGGAG GAAATAGATG ATTTCCATTT GGTTGTCATC
AGTAATAATT TTCCTTATGT GAATTCGCAA CAGGATCATG GTAGATGTGC TTATTTCATT AATATGTTAC CCCTAGTCCC
CTACCATCAG TATATTTACC CCTTTAACTA TAGATTTCTC CTAAAAACCA GTTATCCTTC TTAATGTACA GTGGCTACAT
GCCTATTTCT TTATTCCTTG TATAAACTTG CTTCCAAAGT ATAATAGAGA GTTATGCCTG GATAAAATGC TAGGCTAGGC
CTTTTTTTTT TCTGGTGTTT GGTAGTTGAA ATCAACCATT ATTTCTTTAG TTTTACTTTA ATGGCATTTT ATTTTCTTTA
TCAGCAGATT ATTTTTCTCC AGTTGTTTTG TTTGAGTAAT ATCATATTAT AATAAAACCA CAATGCTAAC ACCCTGTAAT
TTAGGGCAAA TATGATGAAA CAATCAAAGA ATGCACCAAA GCACTTGAGC TGAATCCTTC ATACTTGAAA GCCTTGCTCC
GGAGGGGAGA AGCACATGAA AAGCTTGAAC ACTATGATGA AGCTATTGCT GGTTAGATAT TATTCTCATA ACGTGCTTTA
GATTTAGAGA CTATTTCACA CTATTATTAT TACTATTACC TGTGAGTATT TAGCTCCGAT GCCATATTGT TTAAGTCCTC
TTGTGCTGGG TGTAATCCTC ATCTCAGATA TGAAAAAAAT TATTGAGCTG GATCCTTCAA ATGAACAAGC TAAGAGATCA
CTGTTCCGAC TGGAGCCACT GGCAGCTGAG AAAAGGGAAA AGATGAAGGA AGAGATGATC GGTAATAGTT TCTTCTCAAA
TTTCAGAGTA CTGTGTGCAT TTACTCCTAT GATTTCGGTG TAGTCTGTGT TGCTGTACTC AGGCAACCTT TATGTAAATC
CATCTTTCAT TTTCTTTTTC TAATTGTGCT AGTTAGTTCC AGTTCATCCA AACTAGTTTT ACCTGGTTGA TTATATGGAG
TGCACTGGTA TAGTATGTGC AAGCAACATA ATGAAGTTCT AAATTGTTTA TATAACGTTT GGTCAGAAAA GATGTGTTAT
GATATCCTGA GCCATGCAAA GCTTCTGTAT AACTCTTGAC CTAGTGAAAA ACCTTTTCTG TATCTCAATT TGTGAATATC
TTTCTCTGTT GCAGGAAAGC TCAAAGATCT GGGGAATTCT GTGCTCGGGC GCTTTGGGAT GAGCGTCGAC AATTTCAAAG
CTGTTAAAGA CCCAAACACA GGCTCGTACT CCATTTCGTT CCAGCAGTGA CGACATGGGG TAGTAACGAG TTGTTTAAAT
GAATATGGAC AAGTACACAT GCAGTCACTG TAAATCCTGG AATGCTAATG TCATTTGGTT CAAAAACTTT GGCCCTTTTG
TATCAATAGG TTTGTTACCA TCGCCCGCAG TTAAATCTGA AGATGGTGCA TGGACGTTTG CAGTTATGTT CTGAGAGAGG
TGGTTTAGAT GAGTGAACTT GTATTATAGG CGTTTGCCAC GCTGTGATTC TCTTCATTTT ATCATAGCAA TTCTTGTTTG
CTTGAACAT

Locus: Os10g0486900

Loading...

Locus: Os10g0486900

Loading...