Os10t0498700-01

Locus

Os10g0498700

Description

Orthologue of Arabidopsis SENSITIVE TO FREEZING-6 (AtSFR6), Osmotic stress and freezing tolerance

RAP-DB Gene Symbol Synonym(s)

OsSFR6

RAP-DB Gene Name Synonym(s)

SENSITIVE TO FREEZING-6

CGSNL Gene Symbol

SFR6

CGSNL Gene Name

SENSITIVE TO FREEZING-6

Oryzabase Gene Symbol Synonym(s)

OsMed16_1, Med16_1, OsSFR6

Oryzabase Gene Name Synonym(s)

Mediator 16_1

Transcript Evidence

AK101061

Protein Evidence

Q7G2F7

Literature

PMID: 21585388

Note

Manual Curation

September 7, 2020

Full-length cDNA

J033022G24 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0498700-01)

RiceXPro (AK101061)

Others

Oryzabase (20976)

KEGG (Os10t0498700-01)

Transcript

4539 bp

>Os10t0498700-01 Orthologue of Arabidopsis SENSITIVE TO FREEZING-6 (AtSFR6), Osmotic stress and freezing tolerance
CCTCCCTCTGACTCTCTCCCCGTCGTCGTCATCGTCATCGTCGTTCGTCGTCGTCGTCTC
CCCTTTCCACGGCCGCATCCCATTCCCCACCCAACCTGAAAGCGACGCCGCCGCAGCGCA
CACGCAGGAGGCAGCAGCAAAGCGAGGAGGGGAGGAAACCCTCCCCCCGCGACAGCAACG
GGCGGTCGCTTCCAGTGACCTAAGCCTCCCCCTCCCCCCCTCGCGCGCGCTTCCCTCCCC
TTCGCCTTTTTGTCTCCTCCGCCCCTTATGACCTCTTCCTCCGCCCCAAACCCTAGCCCC
CTCGTCCCCACCCCCACCCCCTCTCCCCCCACCGCCAACGCCGCCGCCGCCGCCGCCGGA
GCCGTGCCCGTCTCCTCGCCGACGCCGCCGCCCAAGGATCAGCAGCAGGAGGGCCAGGGG
GGTGGAGGAGGAGTGGGGGATGGGGGTGGAGTGGAGGAGGTGGGCGTAGGGGGAGGCGAG
GCCATGGAGGTGGATGGTGGCGCGGGAGGTGGTGGTGGGGGGGTTGGGGATGTGGAGGGG
GGTGGGGGTGGTGGTGGTGCGGGGGGAGGAGGAGGTGGAGGTGGAGGTGGGCAGCAGGCG
TCGCCGGCGACCGTGTTCCGGATCCGGCTCAAGCAGCCGCCCTCGAGCCTCCGCCACAAG
ATGCGCGTGCCCGAGCTCTGCAGGAACTTCAGTGCAGTTGCTTGGTGCGGGAAGCTCAAT
GCAATTGCATGCGCATCAGAGACTTGTGCACGCATACCAAGCTCTAATTCAAGCCCACCA
TTTTGGATTCCCATACACATTCTAAATCCAGAGAGACCAACAGAATGTTCTGTTTTCAAT
GTGAAAGCAGATTCTCCACGCGACTTTGTTCAATTCATTGAATGGTCTCCTCGATCATGC
CCTCGTGCATTACTGGTGGCAAATTTTCATGGAAGGATTACTATATGGACACAGCCAACT
AAGGGTCCTACTAATCTTGTACGTGATGCCAGTTCCTGGCAATGTGAACACGAATGGCGT
CAAGATCTTTCGGTGGTGACTAAGTGGTTGTCAGGAATTTCTCCGTATAGATGGCTTCCT
GCAAACTCTAGTACTTCATCAAACTTGAAAACCTTTGAGGAAAAGTTCCTTACCCAGCAG
CCTCAAAGTTCGGCTGGGTGGCCAAACATTCTATGTGTCTGTTCAGTTTTTTCATCGGGT
TCTGTTCAGCTTCATTGGTCACAATGGCCTTCTCAAAACTCAGCACAACCTAGATGGTTT
TCTACTAGCAAAGGGCTTTTAGGAGCAGGGCCAAGCGGCATAATGGCTGCTGATGCTATT
ATTACTGAAACTGGAGCATTACATGTTGCTGGTGTTCCCCTTGTTAATCCATCTACTGTA
GTGGTTTGGGAGGTGATGCCAGGCCTTGGCAATGGTATTCAGGCAACTGCAAAGATAAAT
GCAACAAGCTCTCTTCCTCCATCACTAAATCCCCCACTCTGGGCTGGTTTTGCTCCACTT
GCATCTTACCTCTTCTCTTTGCAAGACTACCTTGTTTCCGAGGGCGCACAGACAAAAAAA
CAGGCACAGGTAGATAATGAGACCACTGAGGTAGCATCGATCCATTGTTGTCCAGTTTCC
AACTTTTCAGCTTACGTCAGTCCTGAAGCTGCTGCCCAGTCAGCCACTACCACAACATGG
GGATCTGGGGTTACCTCAGTTGCTTTTGATCCCACTCGAGGGGGATCAGTTATTACAGTT
GTAATAGTTGAAGGGCAGTACATGTCTCCTTATGATCCTGATGAAGGACCTTCCATCACT
GGATGGAGAGTCCAGTGCTGGGAATCTTCAGTCCAACCTGTTGTTCTTCATCCAATATTT
GGAAGCCCTGCAAACTTTGGTGGACAGCCACCTACACAGACTGTTTGGTCCACAAGAGTT
AACAAAAGCATCCCACCATCTGAGGACCTTAAGAACCCTCAATCATATGTTCCAATGCCA
ACAACTTCAGATGAGCGGAGTTCTTCTGAGTGCAGTGTTGACAGGGCGAACCGACTTAGC
TTTGACCCTTATGATCTTCCAAATGATGTCAGACAATTGGCCCAAATAGTTTATTCTGCT
CATGGTGGTGAGGTTGCAGTTGCATTCCTGCGTGGAGGTGTGCACATTTTTTCAGGTCCA
AACTTTGAACAGGTTGATAGCTATCATGTCAATGTTGGCTCAGCAATTGCTCCACCAGCC
TTCTCCTCCAGTGGTTGTTGCTTGGCATCAGTATGGCATGACACACTCAAAGATCGAACC
ATACTAAAGATAATACGTGTGCTTCCTCCTGCAATTCTTAATGCTCAGACAAAGGTTAGC
TCAGCTGTTTGGGAACGAGCAATAGCAGATAGATTTTGGTGGAGTCTATTGGCTGGTGTG
GATTGGTGGGATGCTGTTGGCTGCACACAAAGTGCTGCTGAAGATGGTATTGTCTCACTG
AACAGTGTGATAGCTTTGCTGGACGCGGACTTCCATTGTCTTCCAACTATACAACAGAGG
CAACAACACTGTCCTAATCTTGATAGGATAAAGTGTAGATTGTTGGAAGGAACAAATGCT
CAAGATGTCAGAGCACTTGTGTTGGACATGCAAGCAAGATTGCTTCTGGATATGCTTGGC
AAGGGAATTGAGTCTGCCCTGATAAATCCATCAACTCTGCTACCTGAACCGTGGCAAGCT
TCCAGTGACATGTTATCTAGCATTGGGCCTGACAAAATGACTGTTGACCCAGCTCTACTT
TTAAGCATCCAGGGGTACGTTGATGCTGTTCTAGATTTAGCGTCACATTTTATCACACGC
TTGCGACGCTATGCGAGCTTCTGCCGAACTTTGGCTAGCCATGCAGTTGGAGCATCTTCT
GGTTCAGGCAATTCTAGGAATATGGTTACAAGTCCAACCAACAGTTCTCCTTCACCTTCA
ACTAACCAAGGTAATCAAGGTGGAGTAGCGTCTACAACAGGGAGCTCACAAATGCAAGAG
TGGGTCCAAGGTGCCATTGCTAAGATTAGTAACAATACTGATGGTGCTGCAAATGCTGCA
CCAAATCCAATTAGCGGGAGGTCATCATTCATGCCTATTAGCATAAATACGGGAACATTC
CCTGGCACACCAGCTGTTAGACTTATTGGGGACTGCCATTTCCTTCATAGATTATGTCAG
CTGTTGCTATTTTGTTTGCTTTTTCGGAGAAGGCAATCTCCAAGGATACCTGCAAATGCA
CAAAAAAGTTCTGATTCTAGCATGCAGAAACAACACTTGATGAACAGTAAGACAGAGGAT
AATACTTTGGCAGTCAGATCTGGTCTAGGTGCTGCCAAATTGGAAGATGGCACAACTTCA
CGTGGACAGATGGTTGGAGCAAAGGGTGCTGAAGAAAATCCAGTGGGCAACAAATCTGCT
AGGATAGGTTCTGGCAATGCTGGCCAAGGTTATACTTCAGACGAGGTGAAAGTCCTTTTT
CTCATATTAGTTGACCTATGTAAACGGACTGCAACCTTGCAACATCCGTTGCCTTCTTCT
CAGGTTGGTTCGAGCAATATTATTATAAGGCTGCATTACATCGATGGCAATTACACTGTG
CTCCCTGAGGTAGTGGAAGCATCTCTTGGCCCTCATATGCAGAATATGCCTCGTCCACGT
GGAGCTGATGCTGCTGGCCTTCTACTTCGAGAATTAGAACTGCAGCCCCCTGCTGAAGAA
TGGCATAGACGCAACATGTTTGGTGGGCCATGGTCAGAACCAGATGATCTTGGTCCATTG
GATAATACGCGACAGCTAAAAATCAATGGCTCTACCAATCGCCACTTATCGGACATGGAA
GAGGATGGCGACAGCTCCTTTGGGATTCAAAATCTTTGGCCAAGAAAGCGCCGGTTGTCT
GAAAGAGATGCAGCATTTGGTCTGAAAACATCCGTGGGGCTGGGATCTTTTCTAGGTGTG
ATGGGTTCTCGGAGAGATGTTATTACAGCTGTGTGGAAAACAGGCCTCGAAGGTGAATGG
TACAAGTGCATACGATGTTTGAGGCAAACCTGTGCATTTGCTCAGCCTGGTGCTCTAGCT
CCGAACACGTCGAATGAGCTTGAGGCATGGTGGATCAGCCGATGGACCCATGCTTGCCCA
ATGTGCGGTGGGACATGGGTGAAAGTCGTTTGAATTTGACGCCTCCGGGCGACACCTTCA
CCGTACTAACCACTCTGCCAATAGCTTTCTCGGCCAAATCTGTGTAGGCGCCATCGGTTT
TTGGACAATTTTGTATCTAACTTTAGATTGTTTGGTCTCAGGCCCTCCCTGGTATGGTAT
CATAGTTTACCTGCAGCAGTCAGAGCAGATTGCACCAGCAGCTGTGTAAAACGGTAGGAA
AAAACAGGATTAGGACATGCCCAAACACTGTCAGAGTCAGCAGTTGTGTTGTGCGATCCT
TTTGTACATAAATGTAGTGTACTAATTTGCAACATTGGAAAAGAAACTCCGTTAGATACT
GCTTGATGTCAATAATATTTGCTGGTGATTGAAAAGACC

CDS

3906 bp

>Os10t0498700-01 Orthologue of Arabidopsis SENSITIVE TO FREEZING-6 (AtSFR6), Osmotic stress and freezing tolerance
ATGACCTCTTCCTCCGCCCCAAACCCTAGCCCCCTCGTCCCCACCCCCACCCCCTCTCCC
CCCACCGCCAACGCCGCCGCCGCCGCCGCCGGAGCCGTGCCCGTCTCCTCGCCGACGCCG
CCGCCCAAGGATCAGCAGCAGGAGGGCCAGGGGGGTGGAGGAGGAGTGGGGGATGGGGGT
GGAGTGGAGGAGGTGGGCGTAGGGGGAGGCGAGGCCATGGAGGTGGATGGTGGCGCGGGA
GGTGGTGGTGGGGGGGTTGGGGATGTGGAGGGGGGTGGGGGTGGTGGTGGTGCGGGGGGA
GGAGGAGGTGGAGGTGGAGGTGGGCAGCAGGCGTCGCCGGCGACCGTGTTCCGGATCCGG
CTCAAGCAGCCGCCCTCGAGCCTCCGCCACAAGATGCGCGTGCCCGAGCTCTGCAGGAAC
TTCAGTGCAGTTGCTTGGTGCGGGAAGCTCAATGCAATTGCATGCGCATCAGAGACTTGT
GCACGCATACCAAGCTCTAATTCAAGCCCACCATTTTGGATTCCCATACACATTCTAAAT
CCAGAGAGACCAACAGAATGTTCTGTTTTCAATGTGAAAGCAGATTCTCCACGCGACTTT
GTTCAATTCATTGAATGGTCTCCTCGATCATGCCCTCGTGCATTACTGGTGGCAAATTTT
CATGGAAGGATTACTATATGGACACAGCCAACTAAGGGTCCTACTAATCTTGTACGTGAT
GCCAGTTCCTGGCAATGTGAACACGAATGGCGTCAAGATCTTTCGGTGGTGACTAAGTGG
TTGTCAGGAATTTCTCCGTATAGATGGCTTCCTGCAAACTCTAGTACTTCATCAAACTTG
AAAACCTTTGAGGAAAAGTTCCTTACCCAGCAGCCTCAAAGTTCGGCTGGGTGGCCAAAC
ATTCTATGTGTCTGTTCAGTTTTTTCATCGGGTTCTGTTCAGCTTCATTGGTCACAATGG
CCTTCTCAAAACTCAGCACAACCTAGATGGTTTTCTACTAGCAAAGGGCTTTTAGGAGCA
GGGCCAAGCGGCATAATGGCTGCTGATGCTATTATTACTGAAACTGGAGCATTACATGTT
GCTGGTGTTCCCCTTGTTAATCCATCTACTGTAGTGGTTTGGGAGGTGATGCCAGGCCTT
GGCAATGGTATTCAGGCAACTGCAAAGATAAATGCAACAAGCTCTCTTCCTCCATCACTA
AATCCCCCACTCTGGGCTGGTTTTGCTCCACTTGCATCTTACCTCTTCTCTTTGCAAGAC
TACCTTGTTTCCGAGGGCGCACAGACAAAAAAACAGGCACAGGTAGATAATGAGACCACT
GAGGTAGCATCGATCCATTGTTGTCCAGTTTCCAACTTTTCAGCTTACGTCAGTCCTGAA
GCTGCTGCCCAGTCAGCCACTACCACAACATGGGGATCTGGGGTTACCTCAGTTGCTTTT
GATCCCACTCGAGGGGGATCAGTTATTACAGTTGTAATAGTTGAAGGGCAGTACATGTCT
CCTTATGATCCTGATGAAGGACCTTCCATCACTGGATGGAGAGTCCAGTGCTGGGAATCT
TCAGTCCAACCTGTTGTTCTTCATCCAATATTTGGAAGCCCTGCAAACTTTGGTGGACAG
CCACCTACACAGACTGTTTGGTCCACAAGAGTTAACAAAAGCATCCCACCATCTGAGGAC
CTTAAGAACCCTCAATCATATGTTCCAATGCCAACAACTTCAGATGAGCGGAGTTCTTCT
GAGTGCAGTGTTGACAGGGCGAACCGACTTAGCTTTGACCCTTATGATCTTCCAAATGAT
GTCAGACAATTGGCCCAAATAGTTTATTCTGCTCATGGTGGTGAGGTTGCAGTTGCATTC
CTGCGTGGAGGTGTGCACATTTTTTCAGGTCCAAACTTTGAACAGGTTGATAGCTATCAT
GTCAATGTTGGCTCAGCAATTGCTCCACCAGCCTTCTCCTCCAGTGGTTGTTGCTTGGCA
TCAGTATGGCATGACACACTCAAAGATCGAACCATACTAAAGATAATACGTGTGCTTCCT
CCTGCAATTCTTAATGCTCAGACAAAGGTTAGCTCAGCTGTTTGGGAACGAGCAATAGCA
GATAGATTTTGGTGGAGTCTATTGGCTGGTGTGGATTGGTGGGATGCTGTTGGCTGCACA
CAAAGTGCTGCTGAAGATGGTATTGTCTCACTGAACAGTGTGATAGCTTTGCTGGACGCG
GACTTCCATTGTCTTCCAACTATACAACAGAGGCAACAACACTGTCCTAATCTTGATAGG
ATAAAGTGTAGATTGTTGGAAGGAACAAATGCTCAAGATGTCAGAGCACTTGTGTTGGAC
ATGCAAGCAAGATTGCTTCTGGATATGCTTGGCAAGGGAATTGAGTCTGCCCTGATAAAT
CCATCAACTCTGCTACCTGAACCGTGGCAAGCTTCCAGTGACATGTTATCTAGCATTGGG
CCTGACAAAATGACTGTTGACCCAGCTCTACTTTTAAGCATCCAGGGGTACGTTGATGCT
GTTCTAGATTTAGCGTCACATTTTATCACACGCTTGCGACGCTATGCGAGCTTCTGCCGA
ACTTTGGCTAGCCATGCAGTTGGAGCATCTTCTGGTTCAGGCAATTCTAGGAATATGGTT
ACAAGTCCAACCAACAGTTCTCCTTCACCTTCAACTAACCAAGGTAATCAAGGTGGAGTA
GCGTCTACAACAGGGAGCTCACAAATGCAAGAGTGGGTCCAAGGTGCCATTGCTAAGATT
AGTAACAATACTGATGGTGCTGCAAATGCTGCACCAAATCCAATTAGCGGGAGGTCATCA
TTCATGCCTATTAGCATAAATACGGGAACATTCCCTGGCACACCAGCTGTTAGACTTATT
GGGGACTGCCATTTCCTTCATAGATTATGTCAGCTGTTGCTATTTTGTTTGCTTTTTCGG
AGAAGGCAATCTCCAAGGATACCTGCAAATGCACAAAAAAGTTCTGATTCTAGCATGCAG
AAACAACACTTGATGAACAGTAAGACAGAGGATAATACTTTGGCAGTCAGATCTGGTCTA
GGTGCTGCCAAATTGGAAGATGGCACAACTTCACGTGGACAGATGGTTGGAGCAAAGGGT
GCTGAAGAAAATCCAGTGGGCAACAAATCTGCTAGGATAGGTTCTGGCAATGCTGGCCAA
GGTTATACTTCAGACGAGGTGAAAGTCCTTTTTCTCATATTAGTTGACCTATGTAAACGG
ACTGCAACCTTGCAACATCCGTTGCCTTCTTCTCAGGTTGGTTCGAGCAATATTATTATA
AGGCTGCATTACATCGATGGCAATTACACTGTGCTCCCTGAGGTAGTGGAAGCATCTCTT
GGCCCTCATATGCAGAATATGCCTCGTCCACGTGGAGCTGATGCTGCTGGCCTTCTACTT
CGAGAATTAGAACTGCAGCCCCCTGCTGAAGAATGGCATAGACGCAACATGTTTGGTGGG
CCATGGTCAGAACCAGATGATCTTGGTCCATTGGATAATACGCGACAGCTAAAAATCAAT
GGCTCTACCAATCGCCACTTATCGGACATGGAAGAGGATGGCGACAGCTCCTTTGGGATT
CAAAATCTTTGGCCAAGAAAGCGCCGGTTGTCTGAAAGAGATGCAGCATTTGGTCTGAAA
ACATCCGTGGGGCTGGGATCTTTTCTAGGTGTGATGGGTTCTCGGAGAGATGTTATTACA
GCTGTGTGGAAAACAGGCCTCGAAGGTGAATGGTACAAGTGCATACGATGTTTGAGGCAA
ACCTGTGCATTTGCTCAGCCTGGTGCTCTAGCTCCGAACACGTCGAATGAGCTTGAGGCA
TGGTGGATCAGCCGATGGACCCATGCTTGCCCAATGTGCGGTGGGACATGGGTGAAAGTC
GTTTGA

Protein

1302 aa

>Os10t0498700-01 Orthologue of Arabidopsis SENSITIVE TO FREEZING-6 (AtSFR6), Osmotic stress and freezing tolerance
MTSSSAPNPSPLVPTPTPSPPTANAAAAAAGAVPVSSPTPPPKDQQQEGQGGGGGVGDGG
GVEEVGVGGGEAMEVDGGAGGGGGGVGDVEGGGGGGGAGGGGGGGGGGQQASPATVFRIR
LKQPPSSLRHKMRVPELCRNFSAVAWCGKLNAIACASETCARIPSSNSSPPFWIPIHILN
PERPTECSVFNVKADSPRDFVQFIEWSPRSCPRALLVANFHGRITIWTQPTKGPTNLVRD
ASSWQCEHEWRQDLSVVTKWLSGISPYRWLPANSSTSSNLKTFEEKFLTQQPQSSAGWPN
ILCVCSVFSSGSVQLHWSQWPSQNSAQPRWFSTSKGLLGAGPSGIMAADAIITETGALHV
AGVPLVNPSTVVVWEVMPGLGNGIQATAKINATSSLPPSLNPPLWAGFAPLASYLFSLQD
YLVSEGAQTKKQAQVDNETTEVASIHCCPVSNFSAYVSPEAAAQSATTTTWGSGVTSVAF
DPTRGGSVITVVIVEGQYMSPYDPDEGPSITGWRVQCWESSVQPVVLHPIFGSPANFGGQ
PPTQTVWSTRVNKSIPPSEDLKNPQSYVPMPTTSDERSSSECSVDRANRLSFDPYDLPND
VRQLAQIVYSAHGGEVAVAFLRGGVHIFSGPNFEQVDSYHVNVGSAIAPPAFSSSGCCLA
SVWHDTLKDRTILKIIRVLPPAILNAQTKVSSAVWERAIADRFWWSLLAGVDWWDAVGCT
QSAAEDGIVSLNSVIALLDADFHCLPTIQQRQQHCPNLDRIKCRLLEGTNAQDVRALVLD
MQARLLLDMLGKGIESALINPSTLLPEPWQASSDMLSSIGPDKMTVDPALLLSIQGYVDA
VLDLASHFITRLRRYASFCRTLASHAVGASSGSGNSRNMVTSPTNSSPSPSTNQGNQGGV
ASTTGSSQMQEWVQGAIAKISNNTDGAANAAPNPISGRSSFMPISINTGTFPGTPAVRLI
GDCHFLHRLCQLLLFCLLFRRRQSPRIPANAQKSSDSSMQKQHLMNSKTEDNTLAVRSGL
GAAKLEDGTTSRGQMVGAKGAEENPVGNKSARIGSGNAGQGYTSDEVKVLFLILVDLCKR
TATLQHPLPSSQVGSSNIIIRLHYIDGNYTVLPEVVEASLGPHMQNMPRPRGADAAGLLL
RELELQPPAEEWHRRNMFGGPWSEPDDLGPLDNTRQLKINGSTNRHLSDMEEDGDSSFGI
QNLWPRKRRLSERDAAFGLKTSVGLGSFLGVMGSRRDVITAVWKTGLEGEWYKCIRCLRQ
TCAFAQPGALAPNTSNELEAWWISRWTHACPMCGGTWVKVV*

5'UTR

chr10:19015819..19016085 (+ strand) : 267 bp

CDS

chr10:19016086..19016510 (+ strand) : 425 bp

chr10:19017197..19017265 (+ strand) : 69 bp

chr10:19017448..19017536 (+ strand) : 89 bp

chr10:19017707..19017819 (+ strand) : 113 bp

chr10:19018004..19018105 (+ strand) : 102 bp

chr10:19018557..19018644 (+ strand) : 88 bp

chr10:19018743..19019342 (+ strand) : 600 bp

chr10:19019747..19020365 (+ strand) : 619 bp

chr10:19020450..19020529 (+ strand) : 80 bp

chr10:19021155..19021237 (+ strand) : 83 bp

chr10:19021777..19022013 (+ strand) : 237 bp

chr10:19022462..19022639 (+ strand) : 178 bp

chr10:19022795..19023309 (+ strand) : 515 bp

chr10:19023721..19023897 (+ strand) : 177 bp

chr10:19024366..19024749 (+ strand) : 384 bp

chr10:19024866..19025012 (+ strand) : 147 bp

3'UTR

chr10:19025013..19025378 (+ strand) : 366 bp

FASTA

>Os10t0498700-01 class=Sequence position=chr10:19015819..19025378 (+ strand)
CCTCCCTCTG ACTCTCTCCC CGTCGTCGTC ATCGTCATCG TCGTTCGTCG TCGTCGTCTC CCCTTTCCAC GGCCGCATCC
CATTCCCCAC CCAACCTGAA AGCGACGCCG CCGCAGCGCA CACGCAGGAG GCAGCAGCAA AGCGAGGAGG GGAGGAAACC
CTCCCCCCGC GACAGCAACG GGCGGTCGCT TCCAGTGACC TAAGCCTCCC CCTCCCCCCC TCGCGCGCGC TTCCCTCCCC
TTCGCCTTTT TGTCTCCTCC GCCCCTTATG ACCTCTTCCT CCGCCCCAAA CCCTAGCCCC CTCGTCCCCA CCCCCACCCC
CTCTCCCCCC ACCGCCAACG CCGCCGCCGC CGCCGCCGGA GCCGTGCCCG TCTCCTCGCC GACGCCGCCG CCCAAGGATC
AGCAGCAGGA GGGCCAGGGG GGTGGAGGAG GAGTGGGGGA TGGGGGTGGA GTGGAGGAGG TGGGCGTAGG GGGAGGCGAG
GCCATGGAGG TGGATGGTGG CGCGGGAGGT GGTGGTGGGG GGGTTGGGGA TGTGGAGGGG GGTGGGGGTG GTGGTGGTGC
GGGGGGAGGA GGAGGTGGAG GTGGAGGTGG GCAGCAGGCG TCGCCGGCGA CCGTGTTCCG GATCCGGCTC AAGCAGCCGC
CCTCGAGCCT CCGCCACAAG ATGCGCGTGC CCGAGCTCTG CAGGAACTTC AGGTGCGTTT CGAGATTAGT TGTGGTTTTT
TTGGGGGTGT TTTTTCTTTC TGGGATTTAA ATATGTTGGG GGAAGCTTAG GTGTGATGAA TTTAAACCCT GATCTGTTTC
agcttattca tcgatttatt gaaatggttt ttttcccccc gaaagaaatt ttcctctact gtattgctta gaccacttgt
tttaagctat ttgttaagtt tgtctctcaa aatatctaat ttatccctat aatatatcca tgacaataat ccactcaata
atctAAATCA AACGATCTGG GTTTACTTTT TTTTTCCTCT TCAAATTTGG GTGGCGTTTC AATGATTGGG ATGAACAATC
TAGTGACTCA AACTTGCAGA AGCATTAGCG TGGGCATGGA ATTGTGATTG CTTTGAATGA TTGTATCCTG TGCAGGCTTC
TACTATACTA GATCAAATAC AGTTATAACA TGTAGTGTCA TTATTTCACA TAACTAAGTT TAGTCAGGTC AAACTGGTTA
CTTTGTTCAC CAGTTAGAAA ATACCGAACG TGATAACTCC ATTTTTAAAA TCCACATTAT TTTTTTTTGT TTAAAACTGC
TTTGATCTTG TAGGATGAGG TTGCCTTGTC TGCTTTAGCC TACACTATAT CGGGAACAAC TAGTAACTAT CTTATCTATG
GTTTTTTTTT TATTGCAGTG CAGTTGCTTG GTGCGGGAAG CTCAATGCAA TTGCATGCGC ATCAGAGACT TGTGCACGCA
TACCAAGGTA TACATTTTTC CATCCTTTCC CTGAAAATTT ACTTTCCTCT GACCTTTAGT TATCCATAAA TAAGTTTGTT
CTGTTAGCTT GTCTTAGTGG GATATTCAAC CATTTGGTAG AATTGTTTGC TTACAGTTTC TGGTTATGAA GGTTTCTTTG
CCGTAAAACG ATCTAATGTA TATTTTCAGC TCTAATTCAA GCCCACCATT TTGGATTCCC ATACACATTC TAAATCCAGA
GAGACCAACA GAATGTTCTG TTTTCAATGT GAAAGCAGGT AATCCATGGC TAAATCTCAA TTGTTTTGGT AATGTGATTA
CGTTATGCAT GTGCAAATCA CTGTCCATTG GGCATTTTAT AGTCAGGTGA AGGGTGAGAT TCAAACTCAC TTTTGTTTAT
ATACGAGTTT TTCTACCTCC AATCCTAACT CACTGTAATT TTGAACAGAT TCTCCACGCG ACTTTGTTCA ATTCATTGAA
TGGTCTCCTC GATCATGCCC TCGTGCATTA CTGGTGGCAA ATTTTCATGG AAGGATTACT ATATGGACAC AGCCAACTAA
GGTACATCTC TACCTTAAGC AAATTTCGGT ATGCATATCA TTTTTTTTTG TTAGTAGTAC CATTGAACTT ACTTTGTTAA
TTTGCGAAAC ACTCAGGATT TTCTTTTTTC ATTTCAAGTC TATATACATA TCATGCTGTT TTGTGTTTTT TCTCTAATAC
TTGTTTCTTT CTTGATATGG TGAAGGGTCC TACTAATCTT GTACGTGATG CCAGTTCCTG GCAATGTGAA CACGAATGGC
GTCAAGATCT TTCGGTGGTG ACTAAGTGGT TGTCAGGAAT TTCTCCGGTT TGTTGCCAAT TTGCAAACTT ACAGTCTGCT
TCTCTTGTTT TTGATAATTA GCACTTTACA CTTGGAATGC AAATATGCAA TACGATTGAC CCAGCAGTTT ATACAGTCCG
CTTCACAATT TAACATTCGA GATTTATATA CTTTTCAGTG TCAATTGTTA ATCATTATTT TTTTAAAATA TAATATTTTA
TAAAGCAGTG ACAATAGACT TGAGTTTAAA CTGTTCTAAG ATTTTTTCAC TGGACATTTA TCATAAACAA TTGCAACAAT
TAGGTAAAAA AGATTCTGGC TCAGTTTATG TCTGAGTAAG TACTTTGATC TATTTCAAAT GACACTACCT GTGTTTGATT
ACCCTTTTGG CCTGAAATAA GTGGATCTTA GAATCGAAGG AATATAATTA CTAAGCTGTT GCCACGGCTA AATTTGTTTT
GTTTCTTTGA CTTTGCAGTA TAGATGGCTT CCTGCAAACT CTAGTACTTC ATCAAACTTG AAAACCTTTG AGGAAAAGTT
CCTTACCCAG CAGCCTCAAA GTTCGGGTTG GTTAAACACA TATATTACTG AGCATATATT TTTTTTGGAG GAGAAAGCAA
GCATGCTTCT TTACGCTACT CTGACATATT GCTGTTTACT GCAGCTGGGT GGCCAAACAT TCTATGTGTC TGTTCAGTTT
TTTCATCGGG TTCTGTTCAG CTTCATTGGT CACAATGGCC TTCTCAAAAC TCAGCACAAC CTAGATGGTT TTCTACTAGC
AAAGGGCTTT TAGGAGCAGG GCCAAGCGGC ATAATGGCTG CTGATGCTAT TATTACTGAA ACTGGAGCAT TACATGTTGC
TGGTGTTCCC CTTGTTAATC CATCTACTGT AGTGGTTTGG GAGGTGATGC CAGGCCTTGG CAATGGTATT CAGGCAACTG
CAAAGATAAA TGCAACAAGC TCTCTTCCTC CATCACTAAA TCCCCCACTC TGGGCTGGTT TTGCTCCACT TGCATCTTAC
CTCTTCTCTT TGCAAGACTA CCTTGTTTCC GAGGGCGCAC AGACAAAAAA ACAGGCACAG GTAGATAATG AGACCACTGA
GGTAGCATCG ATCCATTGTT GTCCAGTTTC CAACTTTTCA GCTTACGTCA GTCCTGAAGC TGCTGCCCAG TCAGCCACTA
CCACAACATG GGGATCTGGG GTTACCTCAG TTGCTTTTGA TCCCACTCGA GGGGGATCAG TTATTACAGT TGTAATAGTT
GAAGGTGCGT ATATGACACC TGGGAAATGA ATTAGTATGA TGCAATTGTC ACATCTCACT ATGACTATTT GTTTCTGATG
AATGGCATGA ACATCAATGC CATTCATAAT CACCACACTA ATCCTATGAT CATCCAACAG CTTTAATAGT AGGAGAGTTA
ATCTAACTAT GTATGTCCAG AGCATGCTTA TACATGTTTT AGCTCCCTTT AGTTGCTTTT GTTGTTTCTT TGATTTGCTC
TGGTAGCTTG TGCCATGGTA ATAAAAGTTC TTGTCTGTAA ATGCTATATG CATATTCTTT TAAGGACTTT TGGGGTCTCT
GAAATTTATT AAGTGAATCG GTTGATCTTA GGCTCTTGGC TAATGCTTAT TTATTTTTTC TGACAATTGT TAAACCACAT
ACTTCCAGGG CAGTACATGT CTCCTTATGA TCCTGATGAA GGACCTTCCA TCACTGGATG GAGAGTCCAG TGCTGGGAAT
CTTCAGTCCA ACCTGTTGTT CTTCATCCAA TATTTGGAAG CCCTGCAAAC TTTGGTGGAC AGCCACCTAC ACAGACTGTT
TGGTCCACAA GAGTTAACAA AAGCATCCCA CCATCTGAGG ACCTTAAGAA CCCTCAATCA TATGTTCCAA TGCCAACAAC
TTCAGATGAG CGGAGTTCTT CTGAGTGCAG TGTTGACAGG GCGAACCGAC TTAGCTTTGA CCCTTATGAT CTTCCAAATG
ATGTCAGACA ATTGGCCCAA ATAGTTTATT CTGCTCATGG TGGTGAGGTT GCAGTTGCAT TCCTGCGTGG AGGTGTGCAC
ATTTTTTCAG GTCCAAACTT TGAACAGGTT GATAGCTATC ATGTCAATGT TGGCTCAGCA ATTGCTCCAC CAGCCTTCTC
CTCCAGTGGT TGTTGCTTGG CATCAGTATG GCATGACACA CTCAAAGATC GAACCATACT AAAGATAATA CGTGTGCTTC
CTCCTGCAAT TCTTAATGCT CAGACAAAGG TTAGCTCAGC TGTTTGGGAA CGAGCAATAG CAGATAGGTA TCCACCCAAG
TTAACAGAGG TTGATTGAAA TGATTTATTT GTTGAAAATG TTTTTTTTTA TAACTGCGAT CTTTTTAGCA GATTTTGGTG
GAGTCTATTG GCTGGTGTGG ATTGGTGGGA TGCTGTTGGC TGCACACAAA GTGCTGCTGA AGATGGTATT GGTAAGGATG
CTTATGCAGA TGCAATTTAA AATTTGTGTA TAGTATTTGC ATTTCAATTG TGTTCTAGCT GTCCACACAA TTAGAAAAGT
AGGGATTATC TGCTACACGG TAGAATTTCC ACAACTGTCA CTCAACCTCT TAAAGTATAt acttcctccg tttcataatg
taagtcattc tagctttttc cacattcata ttgatgttaa tgaatctaga tagatatata tgtctagatt cattaacatc
aatatgaatg tggaaaatgt tagaatgact tacattgtga aacggaggga gtaATTAAGA ACAGTGTAAC CAAGCAAATC
TCTGTTTGGT TGTTTATAAT GTTAAGACTT TAGAGCTGAT TGCACATTTA TGCTCCCAAT TTGAAAGCAT TGTGCATCTG
CAGTATGATG AATTGTGTTT TGCTTCATTT TTCCCATTTG GATGTCTCAA TATGTTAACA TTATTTCCTG GTGTGAGTTG
CAATACATCT TTTTAAGCTG ATACAGAACT TTTCAGTAAG TTTCATCATT TTCTACATAT GGTTGGTTAA CTATTTCAGC
ACCTGTAACA TTTATATTTG TCCATGATAA ACTAAATCTC TTGCTTTTCC TTCCAGTCTC ACTGAACAGT GTGATAGCTT
TGCTGGACGC GGACTTCCAT TGTCTTCCAA CTATACAACA GAGGCAACAA CACTGTCCTG TAAGTGTGCT GTGCTTTTAG
TACATTATGT GCAGTTTTAA GCACAGGCCT TCAATTTTTC ATCATCTACT GCCTACTGCC ATTACTATGT GACATGCATG
TCACAATATC TTTTTGGGTT CTTAAAGATT GTACATTCAC CAATCACCAG TCTTTATTCC ACCAGTAGTT GAAAGGGGGA
TACGAATCAA AATATAATCA AGATGACTTT TTTCCTTTTC TTTCCTGGAC ATAGTTTTTT AGTATTCTTG TGACAAGTCA
CTAGCACTGC TTTGCAGTTC TGAATGAACA TTTTAGCATG AAGCTTGCCA AACTTTTCTA TGAACATAAA TTATATCTCT
GGATGTATTG GTCAGAGACC ATTTACGGTA GTATGTAGTT TGCTACTTTA TTCATAATGC AATATATTGT AATTTGTGAG
TTGGACAAGA TTTGTTTTTC TAATTGTGTG TTTACCTTTT ACTTCAGATT TTGAGGACTT GAAGTTGCAA GGCTATTGCT
TTCTTCTGTT ACTGATTAGT CTATTTTACT TATTGCAGAA TCTTGATAGG ATAAAGTGTA GATTGTTGGA AGGAACAAAT
GCTCAAGATG TCAGAGCACT TGTGTTGGAC ATGCAAGCAA GATTGCTTCT GGATATGCTT GGCAAGGGAA TTGAGTCTGC
CCTGATAAAT CCATCAACTC TGCTACCTGA ACCGTGGCAA GCTTCCAGTG ACATGTTATC TAGCATTGGG CCTGACAAAA
TGACTGTTGA CCCAGCTCTA CTTTTAAGCA TCCAGGTATA CTGTGTTTCA TGTTCTTTTG ATTTCCTGGT CCACAGTTTC
AGTTCAATTT GCTAATCTCG TTTTCCTTTT TTTGGCTATA GACTTAATAT GGGCAAATGA TGTTGCAAAC CTTTTTGAAT
GATAAGCTAT TTGTAAACCA CAACCTATTC ATGCATGAGG ATGAGGCATG ATATGCCACA GATTAACCAT GCCATGTATG
GAATTTACAG TATTTACAGC AGTATTTTGC TGTTTTTATG TTCCAAACCG ACTACGATTC AAACAGCCTC CAGATAGCTT
TCATCATAAG CTTTGCTCCT AGGTGTGCAG GAATTATGCT CAGCCCATCA ACTGCCTCCA ATGCCTTAGC AATTTGTGCA
CACATTTCAG CATAAGCGGT CTGCATATGA ACTTTCATGT TACTATTTTG TGGATTTAAT TTTTTTTTGA ACATGGACTG
CAGGGGTACG TTGATGCTGT TCTAGATTTA GCGTCACATT TTATCACACG CTTGCGACGC TATGCGAGCT TCTGCCGAAC
TTTGGCTAGC CATGCAGTTG GAGCATCTTC TGGTTCAGGC AATTCTAGGA ATATGGTTAC AAGTCCAACC AACAGTTCTC
CTTCACCTTC AACTAACCAA GGTTAATTTT GATTCCGTCT ATCTTGCTAA AGCTTGTGCT TTTTTTTTTG GTGCTAAATA
AAACCACCTA TGAATTATTT GTTTCTTTAT TTAATTTTTT GGAAAATGAC AAGTTGCTGG CACATTTCAA ACTTAGCAAT
GATGCTAATG TTTCAGGTAA TCAAGGTGGA GTAGCGTCTA CAACAGGGAG CTCACAAATG CAAGAGTGGG TCCAAGGTGC
CATTGCTAAG ATTAGTAACA ATACTGATGG TGCTGCAAAT GCTGCACCAA ATCCAATTAG CGGGAGGTCA TCATTCATGC
CTATTAGCAT AAATACGGGA ACATTCCCTG GCACACCAGC TGTTAGACTT ATTGGGGACT GCCATTTCCT TCATAGATTA
TGTCAGCTGT TGCTATTTTG TTTGCTTTTT CGGAGAAGGC AATCTCCAAG GATACCTGCA AATGCACAAA AAAGTTCTGA
TTCTAGCATG CAGAAACAAC ACTTGATGAA CAGTAAGACA GAGGATAATA CTTTGGCAGT CAGATCTGGT CTAGGTGCTG
CCAAATTGGA AGATGGCACA ACTTCACGTG GACAGATGGT TGGAGCAAAG GGTGCTGAAG AAAATCCAGT GGGCAACAAA
TCTGCTAGGA TAGGTTCTGG CAATGCTGGC CAAGGTTATA CTTCAGACGA GGTAACAAAC AAATAACCCA TAAATATGGA
TTTTCTCAGC CTGAATTGTT CAATAAGAAA ACTTTTTTCA ATCTGAAAAT AGTGATAGTT ATACATATAA CAGTATTTTT
GTATGTGCGC TTCGACATCA ATATCTAGCC TGTATTGTTT CTGAATCAAC ATTTAGATTA GAGCTGTTAT ATAGTGTGGT
TATATGTCTG CATATCATAT ATCATGTGTG TGTCTAAATT GTTTGCAAGT GCCATATGAT TAAGGGTAAT TAGACATGAT
TGGATAATTT ACCTAGTATA ATCTTTGATC GGTGATTTGC CCGACATGTT TCTCCCGATT TTATTAGTTG CCTTTCTGAA
AGTATTATTT GTGTAGCACT GTAATACATC TAGTTTCTGA ATTATTTGTT TCATGCTTGC AGGTGAAAGT CCTTTTTCTC
ATATTAGTTG ACCTATGTAA ACGGACTGCA ACCTTGCAAC ATCCGTTGCC TTCTTCTCAG GTTGGTTCGA GCAATATTAT
TATAAGGCTG CATTACATCG ATGGCAATTA CACTGTGCTC CCTGAGGTAG TGGAAGCATC TCTTGGCCCT CATATGCAGG
TACAATACAG ATTTATTGTG GAAGTTTATT TCTGTATTCT CTGTGTACTC ATTAGAGCAT TCAATGTTCT CTTCTCAGCA
ATACATTATA GTAATTCTCA ATTGTGTTGG AGAAATAGAG ATATAGTATT TTGCAAGTTC TACTCTACTT ACCTGGGTTA
ACGATGGATT GATCCAGCAA AAGAATATTG TTGTCCAAGT TAATTATGGA AATTTTCATT TATACAAGCA CACGTGCATA
ATTGGTTTTT ATGATTTCTT TTGTTCATAC GTTCTCCATC TGCCTATATA ATTTATTACT CATGGCCTCA GCGCCCTCTT
GTCACCATTT AGGAGTTCTC ATTTTCATCA GCATGTACAT CTTTGGTAAG AGTAGTGAGC ATGTACATGT CCAACAAGAG
CTGTGTACAC GCATTTCTGT CGAGAATTTA TACCAATGTT GCCCATTTGT TCCAATATTT ATTGCAGAAT ATGCCTCGTC
CACGTGGAGC TGATGCTGCT GGCCTTCTAC TTCGAGAATT AGAACTGCAG CCCCCTGCTG AAGAATGGCA TAGACGCAAC
ATGTTTGGTG GGCCATGGTC AGAACCAGAT GATCTTGGTC CATTGGATAA TACGCGACAG CTAAAAATCA ATGGCTCTAC
CAATCGCCAC TTATCGGACA TGGAAGAGGA TGGCGACAGC TCCTTTGGGA TTCAAAATCT TTGGCCAAGA AAGCGCCGGT
TGTCTGAAAG AGATGCAGCA TTTGGTCTGA AAACATCCGT GGGGCTGGGA TCTTTTCTAG GTGTGATGGG TTCTCGGAGA
GATGTTATTA CAGCTGTGTG GAAAACAGGC CTCGAAGGTG AATGGTACAA GGTAAGCATA CTTGATAGTA GTAGTCTCTA
ACTTCAGTAT TCTTTCAGAA TTAATTATCG ACGCACTCTA TCCAATTCAC CATTTGCCGT GACACCGAGA CATGCTATCT
TTTGCAGTGC ATACGATGTT TGAGGCAAAC CTGTGCATTT GCTCAGCCTG GTGCTCTAGC TCCGAACACG TCGAATGAGC
TTGAGGCATG GTGGATCAGC CGATGGACCC ATGCTTGCCC AATGTGCGGT GGGACATGGG TGAAAGTCGT TTGAATTTGA
CGCCTCCGGG CGACACCTTC ACCGTACTAA CCACTCTGCC AATAGCTTTC TCGGCCAAAT CTGTGTAGGC GCCATCGGTT
TTTGGACAAT TTTGTATCTA ACTTTAGATT GTTTGGTCTC AGGCCCTCCC TGGTATGGTA TCATAGTTTA CCTGCAGCAG
TCAGAGCAGA TTGCACCAGC AGCTGTGTAA AACGGTAGGA AAAAACAGGA TTAGGACATG CCCAAACACT GTCAGAGTCA
GCAGTTGTGT TGTGCGATCC TTTTGTACAT AAATGTAGTG TACTAATTTG CAACATTGGA AAAGAAACTC CGTTAGATAC
TGCTTGATGT CAATAATATT TGCTGGTGAT TGAAAAGACC 

Locus: Os10g0498700

Loading...

Locus: Os10g0498700

Loading...