Os10t0498700-02

Locus

Os10g0498700

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SFR6

CGSNL Gene Name

SENSITIVE TO FREEZING-6

Oryzabase Gene Symbol Synonym(s)

OsMed16_1, Med16_1, OsSFR6

Oryzabase Gene Name Synonym(s)

Mediator 16_1

Transcript Evidence

AK102105 (DDBJ, Best hit)

Protein Evidence

NP_192401.5 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J033084D07 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0498700-02)

RiceXPro (AK102105)

Others

Oryzabase (20976)

KEGG (Os10t0498700-02)

Transcript

2637 bp

>Os10t0498700-02 Similar to predicted protein.
GTTTGGTCCACAAGAGTTAACAAAAGCATCCCACCATCTGAGGACCTTAAGAACCCTCAA
TCATATGTTCCAATGCCAACAACTTCAGATGAGCGGAGTTCTTCTGAGTGCAGTGTTGAC
AGGGCGAACCGACTTAGCTTTGACCCTTATGATCTTCCAAATGATGTCAGACAATTGGCC
CAAATAGTTTATTCTGCTCATGGTGGTGAGGTTGCAGTTGCATTCCTGCGTGGAGGTGTG
CACATTTTTTCAGGTCCAAACTTTGAACAGGTTGATAGCTATCATGTCAATGTTGGCTCA
GCAATTGCTCCACCAGCCTTCTCCTCCAGTGGTTGTTGCTTGGCATCAGTATGGCATGAC
ACACTCAAAGATCGAACCATACTAAAGATAATACGTGTGCTTCCTCCTGCAATTCTTAAT
GCTCAGACAAAGGTTAGCTCAGCTGTTTGGGAACGAGCAATAGCAGATAGATTTTGGTGG
AGTCTATTGGCTGGTGTGGATTGGTGGGATGCTGTTGGCTGCACACAAAGTGCTGCTGAA
GATGGTATTGTCTCACTGAACAGTGTGATAGCTTTGCTGGACGCGGACTTCCATTGTCTT
CCAACTATACAACAGAGGCAACAACACTGTCCTAATCTTGATAGGATAAAGTGTAGATTG
TTGGAAGGAACAAATGCTCAAGATGTCAGAGCACTTGTGTTGGACATGCAAGCAAGATTG
CTTCTGGATATGCTTGGCAAGGGAATTGAGTCTGCCCTGATAAATCCATCAACTCTGCTA
CCTGAACCGTGGCAAGCTTCCAGTGACATGTTATCTAGCATTGGGCCTGACAAAATGACT
GTTGACCCAGCTCTACTTTTAAGCATCCAGGGGTACGTTGATGCTGTTCTAGATTTAGCG
TCACATTTTATCACACGCTTGCGACGCTATGCGAGCTTCTGCCGAACTTTGGCTAGCCAT
GCAGTTGGAGCATCTTCTGGTTCAGGCAATTCTAGGAATATGGTTACAAGTCCAACCAAC
AGTTCTCCTTCACCTTCAACTAACCAAGGTAATCAAGGTGGAGTAGCGTCTACAACAGGG
AGCTCACAAATGCAAGAGTGGGTCCAAGGTGCCATTGCTAAGATTAGTAACAATACTGAT
GGTGCTGCAAATGCTGCACCAAATCCAATTAGCGGGAGGTCATCATTCATGCCTATTAGC
ATAAATACGGGAACATTCCCTGGCACACCAGCTGTTAGACTTATTGGGGACTGCCATTTC
CTTCATAGATTATGTCAGCTGTTGCTATTTTGTTTGCTTTTTCGGAGAAGGCAATCTCCA
AGGATACCTGCAAATGCACAAAAAAGTTCTGATTCTAGCATGCAGAAACAACACTTGATG
AACAGTAAGACAGAGGATAATACTTTGGCAGTCAGATCTGGTCTAGGTGCTGCCAAATTG
GAAGATGGCACAACTTCACGTGGACAGATGGTTGGAGCAAAGGGTGCTGAAGAAAATCCA
GTGGGCAACAAATCTGCTAGGATAGGTTCTGGCAATGCTGGCCAAGGTTATACTTCAGAC
GAGGTGAAAGTCCTTTTTCTCATATTAGTTGACCTATGTAAACGGACTGCAACCTTGCAA
CATCCGTTGCCTTCTTCTCAGGTTGGTTCGAGCAATATTATTATAAGGCTGCATTACATC
GATGGCAATTACACTGTGCTCCCTGAGGTAGTGGAAGCATCTCTTGGCCCTCATATGCAG
AATATGCCTCGTCCACGTGGAGCTGATGCTGCTGGCCTTCTACTTCGAGAATTAGAACTG
CAGCCCCCTGCTGAAGAATGGCATAGACGCAACATGTTTGGTGGGCCATGGTCAGAACCA
GATGATCTTGGTCCATTGGATAATACGCGACAGCTAAAAATCAATGGCTCTACCAATCGC
CACTTATCGGACATGGAAGAGGATGGCGACAGCTCCTTTGGGATTCAAAATCTTTGGCCA
AGAAAGCGCCGGTTGTCTGAAAGAGATGCAGCATTTGGTCTGAAAACATCCGTGGGGCTG
GGATCTTTTCTAGGTGTGATGGGTTCTCGGAGAGATGTTATTACAGCTGTGTGGAAAACA
GGCCTCGAAGGTGAATGGTACAAGTGCATACGATGTTTGAGGCAAACCTGTGCATTTGCT
CAGCCTGGTGCTCTAGCTCCGAACACGTCGAATGAGCTTGAGGCATGGTGGATCAGCCGA
TGGACCCATGCTTGCCCAATGTGCGGTGGGACATGGGTGAAAGTCGTTTGAATTTGACGC
CTCCGGGCGACACCTTCACCGTACTAACCACTCTGCCAATAGCTTTCTCGGCCAAATCTG
TGTAGGCGCCATCGGTTTTTGGACAATTTTGTATCTAACTTTAGATTGTTTGGTCTCAGG
CCCTCCCTGGTATGGTATCATAGTTTACCTGCAGCAGTCAGAGCAGATTGCACCAGCAGC
TGTGTAAAACGGTAGGAAAAAACAGGATTAGGACATGCCCAAACACTGTCAGAGTCAGCA
GTTGTGTTGTGCGATCCTTTTGTACATAAATGTAGTGTACTAATTTGCAACATTGGAAAA
GAAACTCCGTTAGATACTGCTTGATGTCAATAATATTTGCTGGTGATTGAAAAGACC

CDS

2271 bp

>Os10t0498700-02 Similar to predicted protein.
GTTTGGTCCACAAGAGTTAACAAAAGCATCCCACCATCTGAGGACCTTAAGAACCCTCAA
TCATATGTTCCAATGCCAACAACTTCAGATGAGCGGAGTTCTTCTGAGTGCAGTGTTGAC
AGGGCGAACCGACTTAGCTTTGACCCTTATGATCTTCCAAATGATGTCAGACAATTGGCC
CAAATAGTTTATTCTGCTCATGGTGGTGAGGTTGCAGTTGCATTCCTGCGTGGAGGTGTG
CACATTTTTTCAGGTCCAAACTTTGAACAGGTTGATAGCTATCATGTCAATGTTGGCTCA
GCAATTGCTCCACCAGCCTTCTCCTCCAGTGGTTGTTGCTTGGCATCAGTATGGCATGAC
ACACTCAAAGATCGAACCATACTAAAGATAATACGTGTGCTTCCTCCTGCAATTCTTAAT
GCTCAGACAAAGGTTAGCTCAGCTGTTTGGGAACGAGCAATAGCAGATAGATTTTGGTGG
AGTCTATTGGCTGGTGTGGATTGGTGGGATGCTGTTGGCTGCACACAAAGTGCTGCTGAA
GATGGTATTGTCTCACTGAACAGTGTGATAGCTTTGCTGGACGCGGACTTCCATTGTCTT
CCAACTATACAACAGAGGCAACAACACTGTCCTAATCTTGATAGGATAAAGTGTAGATTG
TTGGAAGGAACAAATGCTCAAGATGTCAGAGCACTTGTGTTGGACATGCAAGCAAGATTG
CTTCTGGATATGCTTGGCAAGGGAATTGAGTCTGCCCTGATAAATCCATCAACTCTGCTA
CCTGAACCGTGGCAAGCTTCCAGTGACATGTTATCTAGCATTGGGCCTGACAAAATGACT
GTTGACCCAGCTCTACTTTTAAGCATCCAGGGGTACGTTGATGCTGTTCTAGATTTAGCG
TCACATTTTATCACACGCTTGCGACGCTATGCGAGCTTCTGCCGAACTTTGGCTAGCCAT
GCAGTTGGAGCATCTTCTGGTTCAGGCAATTCTAGGAATATGGTTACAAGTCCAACCAAC
AGTTCTCCTTCACCTTCAACTAACCAAGGTAATCAAGGTGGAGTAGCGTCTACAACAGGG
AGCTCACAAATGCAAGAGTGGGTCCAAGGTGCCATTGCTAAGATTAGTAACAATACTGAT
GGTGCTGCAAATGCTGCACCAAATCCAATTAGCGGGAGGTCATCATTCATGCCTATTAGC
ATAAATACGGGAACATTCCCTGGCACACCAGCTGTTAGACTTATTGGGGACTGCCATTTC
CTTCATAGATTATGTCAGCTGTTGCTATTTTGTTTGCTTTTTCGGAGAAGGCAATCTCCA
AGGATACCTGCAAATGCACAAAAAAGTTCTGATTCTAGCATGCAGAAACAACACTTGATG
AACAGTAAGACAGAGGATAATACTTTGGCAGTCAGATCTGGTCTAGGTGCTGCCAAATTG
GAAGATGGCACAACTTCACGTGGACAGATGGTTGGAGCAAAGGGTGCTGAAGAAAATCCA
GTGGGCAACAAATCTGCTAGGATAGGTTCTGGCAATGCTGGCCAAGGTTATACTTCAGAC
GAGGTGAAAGTCCTTTTTCTCATATTAGTTGACCTATGTAAACGGACTGCAACCTTGCAA
CATCCGTTGCCTTCTTCTCAGGTTGGTTCGAGCAATATTATTATAAGGCTGCATTACATC
GATGGCAATTACACTGTGCTCCCTGAGGTAGTGGAAGCATCTCTTGGCCCTCATATGCAG
AATATGCCTCGTCCACGTGGAGCTGATGCTGCTGGCCTTCTACTTCGAGAATTAGAACTG
CAGCCCCCTGCTGAAGAATGGCATAGACGCAACATGTTTGGTGGGCCATGGTCAGAACCA
GATGATCTTGGTCCATTGGATAATACGCGACAGCTAAAAATCAATGGCTCTACCAATCGC
CACTTATCGGACATGGAAGAGGATGGCGACAGCTCCTTTGGGATTCAAAATCTTTGGCCA
AGAAAGCGCCGGTTGTCTGAAAGAGATGCAGCATTTGGTCTGAAAACATCCGTGGGGCTG
GGATCTTTTCTAGGTGTGATGGGTTCTCGGAGAGATGTTATTACAGCTGTGTGGAAAACA
GGCCTCGAAGGTGAATGGTACAAGTGCATACGATGTTTGAGGCAAACCTGTGCATTTGCT
CAGCCTGGTGCTCTAGCTCCGAACACGTCGAATGAGCTTGAGGCATGGTGGATCAGCCGA
TGGACCCATGCTTGCCCAATGTGCGGTGGGACATGGGTGAAAGTCGTTTGA

Protein

757 aa

>Os10t0498700-02 Similar to predicted protein.
VWSTRVNKSIPPSEDLKNPQSYVPMPTTSDERSSSECSVDRANRLSFDPYDLPNDVRQLA
QIVYSAHGGEVAVAFLRGGVHIFSGPNFEQVDSYHVNVGSAIAPPAFSSSGCCLASVWHD
TLKDRTILKIIRVLPPAILNAQTKVSSAVWERAIADRFWWSLLAGVDWWDAVGCTQSAAE
DGIVSLNSVIALLDADFHCLPTIQQRQQHCPNLDRIKCRLLEGTNAQDVRALVLDMQARL
LLDMLGKGIESALINPSTLLPEPWQASSDMLSSIGPDKMTVDPALLLSIQGYVDAVLDLA
SHFITRLRRYASFCRTLASHAVGASSGSGNSRNMVTSPTNSSPSPSTNQGNQGGVASTTG
SSQMQEWVQGAIAKISNNTDGAANAAPNPISGRSSFMPISINTGTFPGTPAVRLIGDCHF
LHRLCQLLLFCLLFRRRQSPRIPANAQKSSDSSMQKQHLMNSKTEDNTLAVRSGLGAAKL
EDGTTSRGQMVGAKGAEENPVGNKSARIGSGNAGQGYTSDEVKVLFLILVDLCKRTATLQ
HPLPSSQVGSSNIIIRLHYIDGNYTVLPEVVEASLGPHMQNMPRPRGADAAGLLLRELEL
QPPAEEWHRRNMFGGPWSEPDDLGPLDNTRQLKINGSTNRHLSDMEEDGDSSFGIQNLWP
RKRRLSERDAAFGLKTSVGLGSFLGVMGSRRDVITAVWKTGLEGEWYKCIRCLRQTCAFA
QPGALAPNTSNELEAWWISRWTHACPMCGGTWVKVV*

CDS

chr10:19019896..19020365 (+ strand) : 470 bp

chr10:19020450..19020529 (+ strand) : 80 bp

chr10:19021155..19021237 (+ strand) : 83 bp

chr10:19021777..19022013 (+ strand) : 237 bp

chr10:19022462..19022639 (+ strand) : 178 bp

chr10:19022795..19023309 (+ strand) : 515 bp

chr10:19023721..19023897 (+ strand) : 177 bp

chr10:19024366..19024749 (+ strand) : 384 bp

chr10:19024866..19025012 (+ strand) : 147 bp

3'UTR

chr10:19025013..19025378 (+ strand) : 366 bp

FASTA

>Os10t0498700-02 class=Sequence position=chr10:19019896..19025378 (+ strand)
GTTTGGTCCA CAAGAGTTAA CAAAAGCATC CCACCATCTG AGGACCTTAA GAACCCTCAA TCATATGTTC CAATGCCAAC
AACTTCAGAT GAGCGGAGTT CTTCTGAGTG CAGTGTTGAC AGGGCGAACC GACTTAGCTT TGACCCTTAT GATCTTCCAA
ATGATGTCAG ACAATTGGCC CAAATAGTTT ATTCTGCTCA TGGTGGTGAG GTTGCAGTTG CATTCCTGCG TGGAGGTGTG
CACATTTTTT CAGGTCCAAA CTTTGAACAG GTTGATAGCT ATCATGTCAA TGTTGGCTCA GCAATTGCTC CACCAGCCTT
CTCCTCCAGT GGTTGTTGCT TGGCATCAGT ATGGCATGAC ACACTCAAAG ATCGAACCAT ACTAAAGATA ATACGTGTGC
TTCCTCCTGC AATTCTTAAT GCTCAGACAA AGGTTAGCTC AGCTGTTTGG GAACGAGCAA TAGCAGATAG GTATCCACCC
AAGTTAACAG AGGTTGATTG AAATGATTTA TTTGTTGAAA ATGTTTTTTT TTATAACTGC GATCTTTTTA GCAGATTTTG
GTGGAGTCTA TTGGCTGGTG TGGATTGGTG GGATGCTGTT GGCTGCACAC AAAGTGCTGC TGAAGATGGT ATTGGTAAGG
ATGCTTATGC AGATGCAATT TAAAATTTGT GTATAGTATT TGCATTTCAA TTGTGTTCTA GCTGTCCACA CAATTAGAAA
AGTAGGGATT ATCTGCTACA CGGTAGAATT TCCACAACTG TCACTCAACC TCTTAAAGTA TAtacttcct ccgtttcata
atgtaagtca ttctagcttt ttccacattc atattgatgt taatgaatct agatagatat atatgtctag attcattaac
atcaatatga atgtggaaaa tgttagaatg acttacattg tgaaacggag ggagtaATTA AGAACAGTGT AACCAAGCAA
ATCTCTGTTT GGTTGTTTAT AATGTTAAGA CTTTAGAGCT GATTGCACAT TTATGCTCCC AATTTGAAAG CATTGTGCAT
CTGCAGTATG ATGAATTGTG TTTTGCTTCA TTTTTCCCAT TTGGATGTCT CAATATGTTA ACATTATTTC CTGGTGTGAG
TTGCAATACA TCTTTTTAAG CTGATACAGA ACTTTTCAGT AAGTTTCATC ATTTTCTACA TATGGTTGGT TAACTATTTC
AGCACCTGTA ACATTTATAT TTGTCCATGA TAAACTAAAT CTCTTGCTTT TCCTTCCAGT CTCACTGAAC AGTGTGATAG
CTTTGCTGGA CGCGGACTTC CATTGTCTTC CAACTATACA ACAGAGGCAA CAACACTGTC CTGTAAGTGT GCTGTGCTTT
TAGTACATTA TGTGCAGTTT TAAGCACAGG CCTTCAATTT TTCATCATCT ACTGCCTACT GCCATTACTA TGTGACATGC
ATGTCACAAT ATCTTTTTGG GTTCTTAAAG ATTGTACATT CACCAATCAC CAGTCTTTAT TCCACCAGTA GTTGAAAGGG
GGATACGAAT CAAAATATAA TCAAGATGAC TTTTTTCCTT TTCTTTCCTG GACATAGTTT TTTAGTATTC TTGTGACAAG
TCACTAGCAC TGCTTTGCAG TTCTGAATGA ACATTTTAGC ATGAAGCTTG CCAAACTTTT CTATGAACAT AAATTATATC
TCTGGATGTA TTGGTCAGAG ACCATTTACG GTAGTATGTA GTTTGCTACT TTATTCATAA TGCAATATAT TGTAATTTGT
GAGTTGGACA AGATTTGTTT TTCTAATTGT GTGTTTACCT TTTACTTCAG ATTTTGAGGA CTTGAAGTTG CAAGGCTATT
GCTTTCTTCT GTTACTGATT AGTCTATTTT ACTTATTGCA GAATCTTGAT AGGATAAAGT GTAGATTGTT GGAAGGAACA
AATGCTCAAG ATGTCAGAGC ACTTGTGTTG GACATGCAAG CAAGATTGCT TCTGGATATG CTTGGCAAGG GAATTGAGTC
TGCCCTGATA AATCCATCAA CTCTGCTACC TGAACCGTGG CAAGCTTCCA GTGACATGTT ATCTAGCATT GGGCCTGACA
AAATGACTGT TGACCCAGCT CTACTTTTAA GCATCCAGGT ATACTGTGTT TCATGTTCTT TTGATTTCCT GGTCCACAGT
TTCAGTTCAA TTTGCTAATC TCGTTTTCCT TTTTTTGGCT ATAGACTTAA TATGGGCAAA TGATGTTGCA AACCTTTTTG
AATGATAAGC TATTTGTAAA CCACAACCTA TTCATGCATG AGGATGAGGC ATGATATGCC ACAGATTAAC CATGCCATGT
ATGGAATTTA CAGTATTTAC AGCAGTATTT TGCTGTTTTT ATGTTCCAAA CCGACTACGA TTCAAACAGC CTCCAGATAG
CTTTCATCAT AAGCTTTGCT CCTAGGTGTG CAGGAATTAT GCTCAGCCCA TCAACTGCCT CCAATGCCTT AGCAATTTGT
GCACACATTT CAGCATAAGC GGTCTGCATA TGAACTTTCA TGTTACTATT TTGTGGATTT AATTTTTTTT TGAACATGGA
CTGCAGGGGT ACGTTGATGC TGTTCTAGAT TTAGCGTCAC ATTTTATCAC ACGCTTGCGA CGCTATGCGA GCTTCTGCCG
AACTTTGGCT AGCCATGCAG TTGGAGCATC TTCTGGTTCA GGCAATTCTA GGAATATGGT TACAAGTCCA ACCAACAGTT
CTCCTTCACC TTCAACTAAC CAAGGTTAAT TTTGATTCCG TCTATCTTGC TAAAGCTTGT GCTTTTTTTT TTGGTGCTAA
ATAAAACCAC CTATGAATTA TTTGTTTCTT TATTTAATTT TTTGGAAAAT GACAAGTTGC TGGCACATTT CAAACTTAGC
AATGATGCTA ATGTTTCAGG TAATCAAGGT GGAGTAGCGT CTACAACAGG GAGCTCACAA ATGCAAGAGT GGGTCCAAGG
TGCCATTGCT AAGATTAGTA ACAATACTGA TGGTGCTGCA AATGCTGCAC CAAATCCAAT TAGCGGGAGG TCATCATTCA
TGCCTATTAG CATAAATACG GGAACATTCC CTGGCACACC AGCTGTTAGA CTTATTGGGG ACTGCCATTT CCTTCATAGA
TTATGTCAGC TGTTGCTATT TTGTTTGCTT TTTCGGAGAA GGCAATCTCC AAGGATACCT GCAAATGCAC AAAAAAGTTC
TGATTCTAGC ATGCAGAAAC AACACTTGAT GAACAGTAAG ACAGAGGATA ATACTTTGGC AGTCAGATCT GGTCTAGGTG
CTGCCAAATT GGAAGATGGC ACAACTTCAC GTGGACAGAT GGTTGGAGCA AAGGGTGCTG AAGAAAATCC AGTGGGCAAC
AAATCTGCTA GGATAGGTTC TGGCAATGCT GGCCAAGGTT ATACTTCAGA CGAGGTAACA AACAAATAAC CCATAAATAT
GGATTTTCTC AGCCTGAATT GTTCAATAAG AAAACTTTTT TCAATCTGAA AATAGTGATA GTTATACATA TAACAGTATT
TTTGTATGTG CGCTTCGACA TCAATATCTA GCCTGTATTG TTTCTGAATC AACATTTAGA TTAGAGCTGT TATATAGTGT
GGTTATATGT CTGCATATCA TATATCATGT GTGTGTCTAA ATTGTTTGCA AGTGCCATAT GATTAAGGGT AATTAGACAT
GATTGGATAA TTTACCTAGT ATAATCTTTG ATCGGTGATT TGCCCGACAT GTTTCTCCCG ATTTTATTAG TTGCCTTTCT
GAAAGTATTA TTTGTGTAGC ACTGTAATAC ATCTAGTTTC TGAATTATTT GTTTCATGCT TGCAGGTGAA AGTCCTTTTT
CTCATATTAG TTGACCTATG TAAACGGACT GCAACCTTGC AACATCCGTT GCCTTCTTCT CAGGTTGGTT CGAGCAATAT
TATTATAAGG CTGCATTACA TCGATGGCAA TTACACTGTG CTCCCTGAGG TAGTGGAAGC ATCTCTTGGC CCTCATATGC
AGGTACAATA CAGATTTATT GTGGAAGTTT ATTTCTGTAT TCTCTGTGTA CTCATTAGAG CATTCAATGT TCTCTTCTCA
GCAATACATT ATAGTAATTC TCAATTGTGT TGGAGAAATA GAGATATAGT ATTTTGCAAG TTCTACTCTA CTTACCTGGG
TTAACGATGG ATTGATCCAG CAAAAGAATA TTGTTGTCCA AGTTAATTAT GGAAATTTTC ATTTATACAA GCACACGTGC
ATAATTGGTT TTTATGATTT CTTTTGTTCA TACGTTCTCC ATCTGCCTAT ATAATTTATT ACTCATGGCC TCAGCGCCCT
CTTGTCACCA TTTAGGAGTT CTCATTTTCA TCAGCATGTA CATCTTTGGT AAGAGTAGTG AGCATGTACA TGTCCAACAA
GAGCTGTGTA CACGCATTTC TGTCGAGAAT TTATACCAAT GTTGCCCATT TGTTCCAATA TTTATTGCAG AATATGCCTC
GTCCACGTGG AGCTGATGCT GCTGGCCTTC TACTTCGAGA ATTAGAACTG CAGCCCCCTG CTGAAGAATG GCATAGACGC
AACATGTTTG GTGGGCCATG GTCAGAACCA GATGATCTTG GTCCATTGGA TAATACGCGA CAGCTAAAAA TCAATGGCTC
TACCAATCGC CACTTATCGG ACATGGAAGA GGATGGCGAC AGCTCCTTTG GGATTCAAAA TCTTTGGCCA AGAAAGCGCC
GGTTGTCTGA AAGAGATGCA GCATTTGGTC TGAAAACATC CGTGGGGCTG GGATCTTTTC TAGGTGTGAT GGGTTCTCGG
AGAGATGTTA TTACAGCTGT GTGGAAAACA GGCCTCGAAG GTGAATGGTA CAAGGTAAGC ATACTTGATA GTAGTAGTCT
CTAACTTCAG TATTCTTTCA GAATTAATTA TCGACGCACT CTATCCAATT CACCATTTGC CGTGACACCG AGACATGCTA
TCTTTTGCAG TGCATACGAT GTTTGAGGCA AACCTGTGCA TTTGCTCAGC CTGGTGCTCT AGCTCCGAAC ACGTCGAATG
AGCTTGAGGC ATGGTGGATC AGCCGATGGA CCCATGCTTG CCCAATGTGC GGTGGGACAT GGGTGAAAGT CGTTTGAATT
TGACGCCTCC GGGCGACACC TTCACCGTAC TAACCACTCT GCCAATAGCT TTCTCGGCCA AATCTGTGTA GGCGCCATCG
GTTTTTGGAC AATTTTGTAT CTAACTTTAG ATTGTTTGGT CTCAGGCCCT CCCTGGTATG GTATCATAGT TTACCTGCAG
CAGTCAGAGC AGATTGCACC AGCAGCTGTG TAAAACGGTA GGAAAAAACA GGATTAGGAC ATGCCCAAAC ACTGTCAGAG
TCAGCAGTTG TGTTGTGCGA TCCTTTTGTA CATAAATGTA GTGTACTAAT TTGCAACATT GGAAAAGAAA CTCCGTTAGA
TACTGCTTGA TGTCAATAAT ATTTGCTGGT GATTGAAAAG ACC

Locus: Os10g0498700

Loading...

Locus: Os10g0498700

Loading...