Os10t0499500-01

Locus

Os10g0499500

Description

Similar to Fertility restorer.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RF1B

CGSNL Gene Name

RESTORATION OF FERTILITY 1B

Oryzabase Gene Symbol Synonym(s)

RF1b, Rf-1B, PPR7

Oryzabase Gene Name Synonym(s)

pentatricopeptide repeat motif containing gene 7, PPR motif-containing gene 7

Transcript Evidence

AK069398 (DDBJ, Best hit)

AK065378 (DDBJ, Best hit)

Protein Evidence

Q2PPE6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

Pentatricopeptide repeat (IPR002885)

Tetratricopeptide-like helical (IPR011990)

Full-length cDNA

J023011K09 (Online Clone Ordering)

J013020B09 (Online Clone Ordering)

Expression Databases

TENOR (Os10t0499500-01)

Others

Oryzabase (7464)

Transcript

2420 bp

>Os10t0499500-01 Similar to Fertility restorer.
GTCGTCTTCTTCCCGCGCCTTTCGCGAAGCCAACTGCTCGAACGGACGCACCCGTGCAGC
CGCGCTCGTCGGCCGTCGCCGTCGAGGCCGCCCCTCCGCCGCCGCCAGCAGCTGATCCGT
TCGCCATTCCTTCGCGCGCTGGTTTCCACCTTTCCTTGCCCGTCCGTCAGGCCGGACATG
GCACGCCGCGTCGCTGCCCGCGCCCGCGCCCGCGCCGGCGGCGTCCCGCGCTCGGAGGGT
ACGATCCAAGACCGAGCACGCGTTGGGAGCGGTGGCGCCGAGGACGCACTCGACGTGTTC
GACGAATTGCTCCGGCGAGGCATCGGCGCTCCGATCCGCAGCTTGAACGGCGCTCTCGCC
GACGTCGCGCGCGACAACCCCGCGGCCGCTGTGTCCCGCTTCAACCGCATGGCACGAGCT
GGTGCCAGCATGGTAACTCCCACCGTGCACACCTATGGCATCCTCATCGGCTGCTGCTGC
AGTGCGGGCCGCTTAGACCTCGGTTTCGCGGCCTTGGGCCATGTCGTTAAGAAGGGATTC
AGAGTGGAACCCATCATCTTTAATCCTCTGCTCAAGGGCCTCTGTGCAGACAAGAGGACG
GACGACGCAATGGACATAGTGCTCCGTGGAATGACCGAGCTCAGCTGCGTGCCAAATGTC
TTCTCCCACACCATTATTCTCAAGGGACTCTGTCATGAGAACAGAAGCCAAGAAGCTCTC
GAGCTGCTCCACATGATGGCTGATGATGGAGGAGGCTGCTTACCTAATGTTGTGTCATAC
AGCACCGTCATCGATGGCCTCTTGAAAGGAGGGGATCCGGACAAAGCCTACGCTACATAC
CGTGAAATGCTTGACCGGAGGATTTTGCCAAATGTTGTGATTTACAGCTCCATTATTGCT
GCCCTATGCAAGGGTCAAGCAATGGACAAGGCCATGGAGGTACACGATAGGATGGTTAAG
AATGGAGTTACACCCAATTGCTTCACGTATACTAGTCTTGTGCATGGATTTTGCTCTTCA
GGGCAGTTGACAGAGGCTATTAAATTTCTAGAAAAGATGTGCAGCAATGGTGTTGAACCA
AATGTTGTTACTTATAGCTCGTTTATGGACTATCTCTGCAAGAACGGAAGATGCACAGAA
GCTAGAAAGATTTTTGATTCTATGGTCAAGAGGGGCCTAAAGCCTGATATTACTACCTAC
AGTAGCTTACTTCATGGGTATGCTATCGAAGGAGCTCTTGTTGAGATGCATGGTCTCTTT
GATTTGATGGTACAAAGTGATATGCAACCCGATCATTATGTCTTCAACACACTAATATAT
GCATCCGCCAAGCAAGGAAAAGTAGATGAGGCCATGCTTGTATTTAGCAAAATGAGGCAG
CAAGGATTGAAACCTAATTGTGTTACGTATAGCACTTTGATTAATGGCTACTGTAAAATT
ACTAGGATGGAGAATGCTTTAGCACTTTTCCAAGAGATGGTGAGCAATGGTGTTAGTCCT
AATTTTATCACATATAACATAATGCTGCAAGGTTTATTTCGTACAGGAAGAACTGCTACT
GCAAAAGAATTCTATGTACAGATTATCAAAAGTGGCAAAAAAGATCTTATAGAACAGGGG
TTGCTAGAAGAATTGGATGATCTATTTCTTTCAATGGAGGACAATGACTGTAGTACTGTG
TCGACTCCTGCATGCTAAATTGCAGAGTTACAAAGTTACTTCAAAAAGGGGAAGTAGGCA
CTAGGCAGTGCTGGGGTTTACATGTCCAAAATTGATCAAAATAACCTCCCCGTTGAAGCT
TCGACTGTTGATTTGCTGATTTTGCTGATTTCAAGCAGGAAATTCAATCAAACATACGGA
ATTTCTCCCTGAAAAGTTTTGCTCTGAAGTGAAATCCATCCTGTTTGAAATGGCCTACAG
TTATGCAGTTGTAACTGGCTATTGTTGGCCTTCTCACTGAATTAGTAATACAAACAAGAA
ATTCTGGACCACTCTATGTTTGGGGATCACCTTTATCTGTTACATGTGGATTGCTAGGTA
CAAACTGCCCTTTTTTTTGTCACACTATATCTGATTCCCTTCGAAGAAAAATTCCCAGAT
GATATTATAGTTCTCTAATTTTGCTACTTTTTGTAGCTTTGTTAGAACTAATTTATTATC
TGCTAAACTTGCAGTGACAAAGATTCCCCTGTATGATAAATAGCATAGTTAGCAGACTGT
TTCACAGAGGTGCACTAAGCAGAGCTGGTGCTTACCTCTCCATGACTGATGATAAGCACT
TCTCTCTCAAAGCATGGTCTGTTTCCCTGTTTTATAGATCTTTTTTTCTGGAGGCAAACA
CCAAGAATATCATAGGTTTTCCCCTGAAAAGTACAAGTATTTATAGAATATTGGAACCGC
TGAAGATTTTTGCAGCTACG

CDS

1521 bp

>Os10t0499500-01 Similar to Fertility restorer.
ATGGCACGCCGCGTCGCTGCCCGCGCCCGCGCCCGCGCCGGCGGCGTCCCGCGCTCGGAG
GGTACGATCCAAGACCGAGCACGCGTTGGGAGCGGTGGCGCCGAGGACGCACTCGACGTG
TTCGACGAATTGCTCCGGCGAGGCATCGGCGCTCCGATCCGCAGCTTGAACGGCGCTCTC
GCCGACGTCGCGCGCGACAACCCCGCGGCCGCTGTGTCCCGCTTCAACCGCATGGCACGA
GCTGGTGCCAGCATGGTAACTCCCACCGTGCACACCTATGGCATCCTCATCGGCTGCTGC
TGCAGTGCGGGCCGCTTAGACCTCGGTTTCGCGGCCTTGGGCCATGTCGTTAAGAAGGGA
TTCAGAGTGGAACCCATCATCTTTAATCCTCTGCTCAAGGGCCTCTGTGCAGACAAGAGG
ACGGACGACGCAATGGACATAGTGCTCCGTGGAATGACCGAGCTCAGCTGCGTGCCAAAT
GTCTTCTCCCACACCATTATTCTCAAGGGACTCTGTCATGAGAACAGAAGCCAAGAAGCT
CTCGAGCTGCTCCACATGATGGCTGATGATGGAGGAGGCTGCTTACCTAATGTTGTGTCA
TACAGCACCGTCATCGATGGCCTCTTGAAAGGAGGGGATCCGGACAAAGCCTACGCTACA
TACCGTGAAATGCTTGACCGGAGGATTTTGCCAAATGTTGTGATTTACAGCTCCATTATT
GCTGCCCTATGCAAGGGTCAAGCAATGGACAAGGCCATGGAGGTACACGATAGGATGGTT
AAGAATGGAGTTACACCCAATTGCTTCACGTATACTAGTCTTGTGCATGGATTTTGCTCT
TCAGGGCAGTTGACAGAGGCTATTAAATTTCTAGAAAAGATGTGCAGCAATGGTGTTGAA
CCAAATGTTGTTACTTATAGCTCGTTTATGGACTATCTCTGCAAGAACGGAAGATGCACA
GAAGCTAGAAAGATTTTTGATTCTATGGTCAAGAGGGGCCTAAAGCCTGATATTACTACC
TACAGTAGCTTACTTCATGGGTATGCTATCGAAGGAGCTCTTGTTGAGATGCATGGTCTC
TTTGATTTGATGGTACAAAGTGATATGCAACCCGATCATTATGTCTTCAACACACTAATA
TATGCATCCGCCAAGCAAGGAAAAGTAGATGAGGCCATGCTTGTATTTAGCAAAATGAGG
CAGCAAGGATTGAAACCTAATTGTGTTACGTATAGCACTTTGATTAATGGCTACTGTAAA
ATTACTAGGATGGAGAATGCTTTAGCACTTTTCCAAGAGATGGTGAGCAATGGTGTTAGT
CCTAATTTTATCACATATAACATAATGCTGCAAGGTTTATTTCGTACAGGAAGAACTGCT
ACTGCAAAAGAATTCTATGTACAGATTATCAAAAGTGGCAAAAAAGATCTTATAGAACAG
GGGTTGCTAGAAGAATTGGATGATCTATTTCTTTCAATGGAGGACAATGACTGTAGTACT
GTGTCGACTCCTGCATGCTAA

Protein

507 aa

>Os10t0499500-01 Similar to Fertility restorer.
MARRVAARARARAGGVPRSEGTIQDRARVGSGGAEDALDVFDELLRRGIGAPIRSLNGAL
ADVARDNPAAAVSRFNRMARAGASMVTPTVHTYGILIGCCCSAGRLDLGFAALGHVVKKG
FRVEPIIFNPLLKGLCADKRTDDAMDIVLRGMTELSCVPNVFSHTIILKGLCHENRSQEA
LELLHMMADDGGGCLPNVVSYSTVIDGLLKGGDPDKAYATYREMLDRRILPNVVIYSSII
AALCKGQAMDKAMEVHDRMVKNGVTPNCFTYTSLVHGFCSSGQLTEAIKFLEKMCSNGVE
PNVVTYSSFMDYLCKNGRCTEARKIFDSMVKRGLKPDITTYSSLLHGYAIEGALVEMHGL
FDLMVQSDMQPDHYVFNTLIYASAKQGKVDEAMLVFSKMRQQGLKPNCVTYSTLINGYCK
ITRMENALALFQEMVSNGVSPNFITYNIMLQGLFRTGRTATAKEFYVQIIKSGKKDLIEQ
GLLEELDDLFLSMEDNDCSTVSTPAC*

5'UTR

chr10:19056887..19057027 (+ strand) : 141 bp

chr10:19057105..19057140 (+ strand) : 36 bp

CDS

chr10:19057141..19058661 (+ strand) : 1521 bp

3'UTR

chr10:19058662..19059383 (+ strand) : 722 bp

FASTA

>Os10t0499500-01 class=Sequence position=chr10:19056887..19059383 (+ strand)
GTCGTCTTCT TCCCGCGCCT TTCGCGAAGC CAACTGCTCG AACGGACGCA CCCGTGCAGC CGCGCTCGTC GGCCGTCGCC
GTCGAGGCCG CCCCTCCGCC GCCGCCAGCA GCTGATCCGT TCGCCATTCC TTCGCGCGCT GGTTAGTTCC ACCTTCCTTT
GCCTCTGGTT CCTAGTTTCC TAGTAAACCA CGGGGTGATT TATTCAGCGC TGCCGCAGGT TTCCACCTTT CCTTGCCCGT
CCGTCAGGCC GGACATGGCA CGCCGCGTCG CTGCCCGCGC CCGCGCCCGC GCCGGCGGCG TCCCGCGCTC GGAGGGTACG
ATCCAAGACC GAGCACGCGT TGGGAGCGGT GGCGCCGAGG ACGCACTCGA CGTGTTCGAC GAATTGCTCC GGCGAGGCAT
CGGCGCTCCG ATCCGCAGCT TGAACGGCGC TCTCGCCGAC GTCGCGCGCG ACAACCCCGC GGCCGCTGTG TCCCGCTTCA
ACCGCATGGC ACGAGCTGGT GCCAGCATGG TAACTCCCAC CGTGCACACC TATGGCATCC TCATCGGCTG CTGCTGCAGT
GCGGGCCGCT TAGACCTCGG TTTCGCGGCC TTGGGCCATG TCGTTAAGAA GGGATTCAGA GTGGAACCCA TCATCTTTAA
TCCTCTGCTC AAGGGCCTCT GTGCAGACAA GAGGACGGAC GACGCAATGG ACATAGTGCT CCGTGGAATG ACCGAGCTCA
GCTGCGTGCC AAATGTCTTC TCCCACACCA TTATTCTCAA GGGACTCTGT CATGAGAACA GAAGCCAAGA AGCTCTCGAG
CTGCTCCACA TGATGGCTGA TGATGGAGGA GGCTGCTTAC CTAATGTTGT GTCATACAGC ACCGTCATCG ATGGCCTCTT
GAAAGGAGGG GATCCGGACA AAGCCTACGC TACATACCGT GAAATGCTTG ACCGGAGGAT TTTGCCAAAT GTTGTGATTT
ACAGCTCCAT TATTGCTGCC CTATGCAAGG GTCAAGCAAT GGACAAGGCC ATGGAGGTAC ACGATAGGAT GGTTAAGAAT
GGAGTTACAC CCAATTGCTT CACGTATACT AGTCTTGTGC ATGGATTTTG CTCTTCAGGG CAGTTGACAG AGGCTATTAA
ATTTCTAGAA AAGATGTGCA GCAATGGTGT TGAACCAAAT GTTGTTACTT ATAGCTCGTT TATGGACTAT CTCTGCAAGA
ACGGAAGATG CACAGAAGCT AGAAAGATTT TTGATTCTAT GGTCAAGAGG GGCCTAAAGC CTGATATTAC TACCTACAGT
AGCTTACTTC ATGGGTATGC TATCGAAGGA GCTCTTGTTG AGATGCATGG TCTCTTTGAT TTGATGGTAC AAAGTGATAT
GCAACCCGAT CATTATGTCT TCAACACACT AATATATGCA TCCGCCAAGC AAGGAAAAGT AGATGAGGCC ATGCTTGTAT
TTAGCAAAAT GAGGCAGCAA GGATTGAAAC CTAATTGTGT TACGTATAGC ACTTTGATTA ATGGCTACTG TAAAATTACT
AGGATGGAGA ATGCTTTAGC ACTTTTCCAA GAGATGGTGA GCAATGGTGT TAGTCCTAAT TTTATCACAT ATAACATAAT
GCTGCAAGGT TTATTTCGTA CAGGAAGAAC TGCTACTGCA AAAGAATTCT ATGTACAGAT TATCAAAAGT GGCAAAAAAG
ATCTTATAGA ACAGGGGTTG CTAGAAGAAT TGGATGATCT ATTTCTTTCA ATGGAGGACA ATGACTGTAG TACTGTGTCG
ACTCCTGCAT GCTAAATTGC AGAGTTACAA AGTTACTTCA AAAAGGGGAA GTAGGCACTA GGCAGTGCTG GGGTTTACAT
GTCCAAAATT GATCAAAATA ACCTCCCCGT TGAAGCTTCG ACTGTTGATT TGCTGATTTT GCTGATTTCA AGCAGGAAAT
TCAATCAAAC ATACGGAATT TCTCCCTGAA AAGTTTTGCT CTGAAGTGAA ATCCATCCTG TTTGAAATGG CCTACAGTTA
TGCAGTTGTA ACTGGCTATT GTTGGCCTTC TCACTGAATT AGTAATACAA ACAAGAAATT CTGGACCACT CTATGTTTGG
GGATCACCTT TATCTGTTAC ATGTGGATTG CTAGGTACAA ACTGCCCTTT TTTTTGTCAC ACTATATCTG ATTCCCTTCG
AAGAAAAATT CCCAGATGAT ATTATAGTTC TCTAATTTTG CTACTTTTTG TAGCTTTGTT AGAACTAATT TATTATCTGC
TAAACTTGCA GTGACAAAGA TTCCCCTGTA TGATAAATAG CATAGTTAGC AGACTGTTTC ACAGAGGTGC ACTAAGCAGA
GCTGGTGCTT ACCTCTCCAT GACTGATGAT AAGCACTTCT CTCTCAAAGC ATGGTCTGTT TCCCTGTTTT ATAGATCTTT
TTTTCTGGAG GCAAACACCA AGAATATCAT AGGTTTTCCC CTGAAAAGTA CAAGTATTTA TAGAATATTG GAACCGCTGA
AGATTTTTGC AGCTACG